Details of the Target
General Information of Target
| Target ID | LDTP13346 | |||||
|---|---|---|---|---|---|---|
| Target Name | Solute carrier organic anion transporter family member 3A1 (SLCO3A1) | |||||
| Gene Name | SLCO3A1 | |||||
| Gene ID | 28232 | |||||
| Synonyms |
OATP3A1; OATPD; SLC21A11; Solute carrier organic anion transporter family member 3A1; OATP3A1; Organic anion transporter polypeptide-related protein 3; OATP-RP3; OATPRP3; Organic anion-transporting polypeptide D; OATP-D; PGE1 transporter; Sodium-independent organic anion transporter D; Solute carrier family 21 member 11
|
|||||
| 3D Structure | ||||||
| Sequence |
MILNWKLLGILVLCLHTRGISGSEGHPSHPPAEDREEAGSPTLPQGPPVPGDPWPGAPPL
FEDPPPTRPSRPWRDLPETGVWLPEPPRTDPPQPPRPDDPWPAGPQPPENPWPPAPEVDN RPQEEPDLDPPREEYR |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Organo anion transporter (TC 2.A.60) family
|
|||||
| Subcellular location |
Multi-pass membrane protein; Basolateral cell membrane; Basal cell membrane; Cell membrane
|
|||||
| Function |
Putative organic anion antiporter with apparent broad substrate specificity. Recognizes various substrates including thyroid hormone L-thyroxine, prostanoids such as prostaglandin E1 and E2, bile acids such as taurocholate, glycolate and glycochenodeoxycholate and peptide hormones such as L-arginine vasopressin, likely operating in a tissue-specific manner. The transport mechanism, its electrogenicity and potential tissue-specific counterions remain to be elucidated (Probable).
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
TFBX Probe Info |
![]() |
N.A. | LDD0148 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Aquaporin-6 (AQP6) | MIP/aquaporin (TC 1.A.8) family | Q13520 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Golgi membrane protein 1 (GOLM1) | GOLM family | Q8NBJ4 | |||
The Drug(s) Related To This Target
Approved
Investigative
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Lobeglitazone | Small molecular drug | DB09198 | |||
| [3h]Estrone-3-sulphate | Small molecular drug | D04AXP | |||

