Details of the Target
General Information of Target
Target ID | LDTP13346 | |||||
---|---|---|---|---|---|---|
Target Name | Solute carrier organic anion transporter family member 3A1 (SLCO3A1) | |||||
Gene Name | SLCO3A1 | |||||
Gene ID | 28232 | |||||
Synonyms |
OATP3A1; OATPD; SLC21A11; Solute carrier organic anion transporter family member 3A1; OATP3A1; Organic anion transporter polypeptide-related protein 3; OATP-RP3; OATPRP3; Organic anion-transporting polypeptide D; OATP-D; PGE1 transporter; Sodium-independent organic anion transporter D; Solute carrier family 21 member 11
|
|||||
3D Structure | ||||||
Sequence |
MILNWKLLGILVLCLHTRGISGSEGHPSHPPAEDREEAGSPTLPQGPPVPGDPWPGAPPL
FEDPPPTRPSRPWRDLPETGVWLPEPPRTDPPQPPRPDDPWPAGPQPPENPWPPAPEVDN RPQEEPDLDPPREEYR |
|||||
Target Type |
Literature-reported
|
|||||
Target Bioclass |
Transporter and channel
|
|||||
Family |
Organo anion transporter (TC 2.A.60) family
|
|||||
Subcellular location |
Multi-pass membrane protein; Basolateral cell membrane; Basal cell membrane; Cell membrane
|
|||||
Function |
Putative organic anion antiporter with apparent broad substrate specificity. Recognizes various substrates including thyroid hormone L-thyroxine, prostanoids such as prostaglandin E1 and E2, bile acids such as taurocholate, glycolate and glycochenodeoxycholate and peptide hormones such as L-arginine vasopressin, likely operating in a tissue-specific manner. The transport mechanism, its electrogenicity and potential tissue-specific counterions remain to be elucidated (Probable).
|
|||||
TTD ID | ||||||
Uniprot ID | ||||||
DrugMap ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
TFBX Probe Info |
![]() |
N.A. | LDD0148 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Aquaporin-6 (AQP6) | MIP/aquaporin (TC 1.A.8) family | Q13520 |
Other
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Golgi membrane protein 1 (GOLM1) | GOLM family | Q8NBJ4 |
The Drug(s) Related To This Target
Approved
Investigative
Drug Name | Drug Type | External ID | |||
---|---|---|---|---|---|
Lobeglitazone | Small molecular drug | DB09198 | |||
[3h]Estrone-3-sulphate | Small molecular drug | D04AXP |