Details of the Target
General Information of Target
| Target ID | LDTP13324 | |||||
|---|---|---|---|---|---|---|
| Target Name | Glutaminase liver isoform, mitochondrial (GLS2) |
|
||||
| Gene Name | GLS2 | |||||
| Gene ID | 27165 | |||||
| Synonyms |
GA; Glutaminase liver isoform, mitochondrial; GLS; EC 3.5.1.2; L-glutaminase; L-glutamine amidohydrolase |
|||||
| 3D Structure | ||||||
| Sequence |
MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADN
LRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSE EETES |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Glutaminase family
|
|||||
| Subcellular location |
Mitochondrion
|
|||||
| Function |
Plays an important role in the regulation of glutamine catabolism. Promotes mitochondrial respiration and increases ATP generation in cells by catalyzing the synthesis of glutamate and alpha-ketoglutarate. Increases cellular anti-oxidant function via NADH and glutathione production. May play a role in preventing tumor proliferation.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| A172 | Deletion: p.D60IfsTer37 | . | |||
| DU145 | SNV: p.L233I | DBIA Probe Info | |||
| HT115 | SNV: p.I375V | . | |||
| HUH7 | SNV: p.P56Q | . | |||
| JHH7 | SNV: p.A45V | . | |||
| KMRC3 | SNV: p.G419E | DBIA Probe Info | |||
| MOLT4 | SNV: p.V208L | . | |||
| TCCSUP | SNV: p.A227V | . | |||
| TGBC1TKB | SNV: p.F401L | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C542(107.61) | LDD0209 | [1] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References