Details of the Target
General Information of Target
Target ID | LDTP13298 | |||||
---|---|---|---|---|---|---|
Target Name | Inactive cell surface hyaluronidase CEMIP2 (CEMIP2) | |||||
Gene Name | CEMIP2 | |||||
Gene ID | 23670 | |||||
Synonyms |
KIAA1412; TMEM2; Inactive cell surface hyaluronidase CEMIP2; Cell migration-inducing hyaluronidase 2; Transmembrane protein 2 |
|||||
3D Structure | ||||||
Sequence |
MRSRVAVRACHKVCRCLLSGFGGRVDAGQPELLTERSSPKGGHVKSHAELEGNGEHPEAP
GSGEGSEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVV FREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGK LRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLV WFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELI ETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENS FTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLET MQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYIS SAKNV |
|||||
Target Bioclass |
Other
|
|||||
Family |
CEMIP family
|
|||||
Subcellular location |
Cell membrane
|
|||||
Function |
Unlike its mouse ortholog has no catalytic hyaluronic acid-degrading activity, but acts as a regulator of hyaluronan (HA) metabolism through regulation of expression of CEMIP and HAS2, two enzymes involved in HA depolymerization and HA synthesis, respectively.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Cell line | Mutation details | Probe for labeling this protein in this cell | |||
---|---|---|---|---|---|
22RV1 | SNV: p.D556G; p.I1353T | . | |||
HEC1 | SNV: p.R333W | . | |||
HEC1B | SNV: p.R333W | . | |||
HL60 | SNV: p.N914S | . | |||
HT115 | SNV: p.N525T; p.E820Ter | . | |||
HUH7 | SNV: p.P768Q | DBIA Probe Info | |||
Ishikawa (Heraklio) 02 ER | Substitution: p.K77_R78delinsNTer | . | |||
KYSE150 | SNV: p.A87P | . | |||
MELJUSO | SNV: p.S249F | DBIA Probe Info | |||
MM1S | SNV: p.S397N | . | |||
NCIH1793 | SNV: p.N1018S | . | |||
NCIH2172 | SNV: p.E1359Ter | . | |||
RKO | SNV: p.R54Ter | . | |||
SNGM | Substitution: p.F254V | . | |||
SNU308 | SNV: p.A1030G | . | |||
T98G | SNV: p.R302T | . | |||
TOV21G | SNV: p.P1363L | . |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
YN-1 Probe Info |
![]() |
100.00 | LDD0444 | [1] | |
STPyne Probe Info |
![]() |
K1262(10.00); K1377(5.57); K733(10.00) | LDD0277 | [2] | |
OPA-S-S-alkyne Probe Info |
![]() |
K856(0.77); K887(1.21); K1278(1.31); K846(1.51) | LDD3494 | [3] | |
HHS-475 Probe Info |
![]() |
Y847(0.23) | LDD0268 | [4] | |
DBIA Probe Info |
![]() |
C1192(1.09); C1195(1.09) | LDD0078 | [5] | |
IA-alkyne Probe Info |
![]() |
N.A. | LDD0162 | [6] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0020 | ARS-1620 | HCC44 | C1192(1.09); C1195(1.09) | LDD0078 | [5] |
LDCM0371 | CL102 | HEK-293T | C1253(0.89) | LDD1575 | [7] |
LDCM0375 | CL106 | HEK-293T | C1253(0.76) | LDD1579 | [7] |
LDCM0380 | CL110 | HEK-293T | C1253(0.79) | LDD1584 | [7] |
LDCM0384 | CL114 | HEK-293T | C1253(0.98) | LDD1588 | [7] |
LDCM0388 | CL118 | HEK-293T | C1253(0.87) | LDD1592 | [7] |
LDCM0393 | CL122 | HEK-293T | C1253(0.92) | LDD1597 | [7] |
LDCM0397 | CL126 | HEK-293T | C1253(0.96) | LDD1601 | [7] |
LDCM0401 | CL14 | HEK-293T | C1253(1.07) | LDD1605 | [7] |
LDCM0407 | CL2 | HEK-293T | C1253(0.71) | LDD1611 | [7] |
LDCM0414 | CL26 | HEK-293T | C1253(1.03) | LDD1618 | [7] |
LDCM0441 | CL50 | HEK-293T | C1253(1.03) | LDD1645 | [7] |
LDCM0454 | CL62 | HEK-293T | C1253(1.03) | LDD1657 | [7] |
LDCM0467 | CL74 | HEK-293T | C1253(0.86) | LDD1670 | [7] |
LDCM0480 | CL86 | HEK-293T | C1253(1.04) | LDD1683 | [7] |
LDCM0493 | CL98 | HEK-293T | C1253(0.91) | LDD1696 | [7] |
LDCM0427 | Fragment51 | HEK-293T | C1253(0.76) | LDD1631 | [7] |
LDCM0120 | HHS-0701 | DM93 | Y847(0.23) | LDD0268 | [4] |
LDCM0022 | KB02 | A2058 | C554(1.70) | LDD2253 | [8] |
LDCM0023 | KB03 | A2058 | C750(2.47); C554(2.13) | LDD2670 | [8] |
LDCM0024 | KB05 | HMCB | C750(1.98); C554(1.35) | LDD3312 | [8] |
The Interaction Atlas With This Target
References