Details of the Target
General Information of Target
| Target ID | LDTP13223 | |||||
|---|---|---|---|---|---|---|
| Target Name | Peptide chain release factor 1-like, mitochondrial (MTRF1L) | |||||
| Gene Name | MTRF1L | |||||
| Gene ID | 54516 | |||||
| Synonyms |
MTRF1A; Peptide chain release factor 1-like, mitochondrial; Mitochondrial translational release factor 1-like; mtRF1a |
|||||
| 3D Structure | ||||||
| Sequence |
MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTK
MESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDL KKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYT LMHRDSFPRFLNSQIYKSFVESTAGSSSES |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Prokaryotic/mitochondrial release factor family
|
|||||
| Subcellular location |
Mitochondrion
|
|||||
| Function | Mitochondrial peptide chain release factor that directs the termination of translation in response to the peptide chain termination codons UAA and UAG. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| HEC1 | SNV: p.H83Y; p.D125G | . | |||
| HEC1B | SNV: p.H83Y | . | |||
| IM95 | SNV: p.N283D | DBIA Probe Info | |||
| NCIH1048 | SNV: p.Q314R | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
 |
N.A. | LDD0241 | [1] | |
|
DBIA Probe Info |
 |
C103(1.49) | LDD3346 | [2] | |
|
IA-alkyne Probe Info |
 |
N.A. | LDD0165 | [3] | |
Competitor(s) Related to This Target
References