Details of the Target

General Information of Target

Target ID LDTP13215
Target Name Dynein axonemal heavy chain 17 (DNAH17)
Gene Name DNAH17
Gene ID 8632
Synonyms
DNAHL1; DNEL2; Dynein axonemal heavy chain 17; Axonemal beta dynein heavy chain 17; Axonemal dynein heavy chain-like protein 1; Ciliary dynein heavy chain 17; Ciliary dynein heavy chain-like protein 1; Dynein axonemal light chain 2
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MGSKAKKRVLLPTRPAPPTVEQILEDVRGAPAEDPVFTILAPEDPPVPFRMMEDAEAPGE
QLYQQSRAYVAANQRLQQAGNVLRQRCELLQRAGEDLEREVAQMKQAALPAAEAASSG
Target Bioclass
Other
Family
Dynein heavy chain family
Subcellular location
Cytoplasm, cytoskeleton, flagellum axoneme
Function
Force generating protein component of the outer dynein arms (ODAs) in the sperm flagellum. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP (Probable). Plays a major role in sperm motility, implicated in sperm flagellar assembly and beating.
Uniprot ID
Q9UFH2
Ensemble ID
ENST00000389840.7
HGNC ID
HGNC:2946

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
ABC1 SNV: p.W27G .
CAL51 SNV: p.K1887R .
CCK81 SNV: p.R2585H; p.A2848V .
CMK SNV: p.S3421G .
COLO792 SNV: p.C528W .
CORL88 SNV: p.P2039S .
DETROIT562 SNV: p.V1197L; p.K3949E .
DU145 SNV: p.A801V .
HCC1395 SNV: p.M2545K .
HCT116 Deletion: p.G447AfsTer11 .
HEC1 SNV: p.E3915G .
HEC1B SNV: p.A491V .
HT115 SNV: p.F2650L .
HT1376 SNV: p.D2694N .
HUCCT1 SNV: p.G3982D .
ICC10 SNV: p.C1052Y .
ICC106 SNV: p.C1052Y .
ICC108 SNV: p.C1052Y .
IGR1 SNV: p.P3980S .
IM95 SNV: p.F877L .
IPC298 SNV: p.E1352K .
Ishikawa (Heraklio) 02 ER SNV: p.L3148R .
JURKAT Deletion: p.N2796MfsTer50
SNV: p.D3081N		 .
KASUMI1 Substitution: p.D2475N .
KU1919 Substitution: p.D2475N .
KYM1 SNV: p.I3979M .
KYSE510 SNV: p.G791E .
LNCaP clone FGC SNV: p.V3039A; p.A3324S .
MEWO SNV: p.D564N;p.T2226I;p.D3573N
Substitution: p.S3713F		 .
MM1S SNV: p.Q1645H .
MOLT4 SNV: p.Q269Ter; p.A980V; p.S2214F; p.V3110I; p.T3822M .
NCIH358 SNV: p.M152I .
OE33 SNV: p.P3974L .
OVCAR5 SNV: p.L669I .
PC3 SNV: p.E2880D .
PF382 SNV: p.H1091Y .
RL952 SNV: p.E3000G .
RVH421 SNV: p.D958Y .
SHP77 SNV: p.K3524Q .
SKMEL5 SNV: p.E706K .
SNGM SNV: p.G2513C .
SNU1196 Substitution: p.D2475N .
SUPT1 Insertion: p.F2406VfsTer7
SNV: p.T3351R		 .
SW620 SNV: p.E1491K .
SW948 SNV: p.W1704R .
TE8 SNV: p.A3689P .
TGBC52TKB Substitution: p.D2475N .
TOV21G SNV: p.F420L; p.R3858L .
VMRCRCW SNV: p.G1934R .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
NAIA_4
 Probe Info  		N.A.  LDD2226  [1]
IPM
 Probe Info  		N.A.  LDD0147  [2]
PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STS-2
 Probe Info  		N.A.  LDD0139  [3]

References

1 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
2 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
3 Design and synthesis of minimalist terminal alkyne-containing diazirine photo-crosslinkers and their incorporation into kinase inhibitors for cell- and tissue-based proteome profiling. Angew Chem Int Ed Engl. 2013 Aug 12;52(33):8551-6. doi: 10.1002/anie.201300683. Epub 2013 Jun 10.