Details of the Target
General Information of Target
| Target ID | LDTP13168 | |||||
|---|---|---|---|---|---|---|
| Target Name | Bridging integrator 2 (BIN2) | |||||
| Gene Name | BIN2 | |||||
| Gene ID | 51411 | |||||
| Synonyms |
BRAP1; Bridging integrator 2; Breast cancer-associated protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MASYPYRQGCPGAAGQAPGAPPGSYYPGPPNSGGQYGSGLPPGGGYGGPAPGGPYGPPAG
GGPYGHPNPGMFPSGTPGGPYGGAAPGGPYGQPPPSSYGAQQPGLYGQGGAPPNVDPEAY SWFQSVDSDHSGYISMKELKQALVNCNWSSFNDETCLMMINMFDKTKSGRIDVYGFSALW KFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSPQFTQLLVSRYCPRSANPAMQL DRFIQVCTQLQVLTEAFREKDTAVQGNIRLSFEDFVTMTASRML |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Promotes cell motility and migration, probably via its interaction with the cell membrane and with podosome proteins that mediate interaction with the cytoskeleton. Modulates membrane curvature and mediates membrane tubulation. Plays a role in podosome formation. Inhibits phagocytosis.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| COLO792 | SNV: p.N106I | . | |||
| JURKAT | SNV: p.N106I | . | |||
| MINO | SNV: p.S369T | . | |||
| MOLT4 | SNV: p.R258H | IA-alkyne Probe Info | |||
| SUPT1 | SNV: p.G4C | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C205(3.63) | LDD3370 | [1] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0166 | [2] | |
|
HHS-465 Probe Info |
![]() |
N.A. | LDD2240 | [3] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References



