Details of the Target
General Information of Target
| Target ID | LDTP13139 | |||||
|---|---|---|---|---|---|---|
| Target Name | Hairy/enhancer-of-split related with YRPW motif protein 2 (HEY2) | |||||
| Gene Name | HEY2 | |||||
| Gene ID | 23493 | |||||
| Synonyms |
BHLHB32; CHF1; GRL; HERP; HERP1; HRT2; Hairy/enhancer-of-split related with YRPW motif protein 2; Cardiovascular helix-loop-helix factor 1; hCHF1; Class B basic helix-loop-helix protein 32; bHLHb32; HES-related repressor protein 2; Hairy and enhancer of split-related protein 2; HESR-2; Hairy-related transcription factor 2; HRT-2; hHRT2; Protein gridlock homolog
|
|||||
| 3D Structure | ||||||
| Sequence |
MQRLGATLLCLLLAAAVPTAPAPAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMED
TQHKLRSAVEEMEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITN NQTGQMVFSETVITSVGDEEGRRSHECIIDEDCGPSMYCQFASFQYTCQPCRGQRMLCTR DSECCGDQLCVWGHCTKMATRGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGEL CHDPASRLLDLITWELEPDGALDRCPCASGLLCQPHSHSLVYVCKPTFVGSRDQDGEILL PREVPDEYEVGSFMEEVRQELEDLERSLTEEMALREPAAAAAALLGGEEI |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
HEY family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Downstream effector of Notch signaling which may be required for cardiovascular development. Transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGTG-3'. Represses transcription by the cardiac transcriptional activators GATA4 and GATA6.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2225 | [1] | |

