Details of the Target
General Information of Target
| Target ID | LDTP13121 | |||||
|---|---|---|---|---|---|---|
| Target Name | ATP-binding cassette sub-family D member 2 (ABCD2) | |||||
| Gene Name | ABCD2 | |||||
| Gene ID | 225 | |||||
| Synonyms |
ALD1; ALDL1; ALDR; ALDRP; ATP-binding cassette sub-family D member 2; EC 3.1.2.-; EC 7.6.2.-; Adrenoleukodystrophy-like 1; Adrenoleukodystrophy-related protein; hALDR |
|||||
| 3D Structure | ||||||
| Sequence |
MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSE
NPFKDKKTCIIL |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
ABC transporter superfamily, ABCD family, Peroxisomal fatty acyl CoA transporter (TC 3.A.1.203) subfamily
|
|||||
| Subcellular location |
Peroxisome membrane
|
|||||
| Function |
ATP-dependent transporter of the ATP-binding cassette (ABC) family involved in the transport of very long chain fatty acid (VLCFA)-CoA from the cytosol to the peroxisome lumen. Like ABCD1 seems to have fatty acyl-CoA thioesterase (ACOT) and ATPase activities, according to this model, VLCFA-CoA as free VLCFA is transpoted in an ATP-dependent manner into peroxisomes after the hydrolysis of VLCFA-CoA mediated by the ACOT activity of ABCD2 (Probable). Shows overlapping substrate specificities with ABCD1 toward saturated fatty acids (FA) and monounsaturated FA (MUFA) but has a distinct substrate preference for shorter VLCFA (C22:0) and polyunsaturated fatty acid (PUFA) such as C22:6-CoA and C24:6-CoA (in vitro). Thus, may play a role in regulation of VLCFAs and energy metabolism namely, in the degradation and biosynthesis of fatty acids by beta-oxidation.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C515(2.44) | LDD3312 | [1] | |
|
W1 Probe Info |
![]() |
N.A. | LDD0236 | [2] | |
Competitor(s) Related to This Target
References


