Details of the Target
General Information of Target
| Target ID | LDTP13002 | |||||
|---|---|---|---|---|---|---|
| Target Name | Calcium permeable stress-gated cation channel 1 (TMEM63C) | |||||
| Gene Name | TMEM63C | |||||
| Gene ID | 57156 | |||||
| Synonyms |
C14orf171; CSC1; Calcium permeable stress-gated cation channel 1; Transmembrane protein 63C |
|||||
| 3D Structure | ||||||
| Sequence |
MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVV
FHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKF QEKEDS |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
CSC1 (TC 1.A.17) family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function | Acts as an osmosensitive calcium-permeable cation channel. Required for the functional integrity of the kidney glomerular filtration barrier. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C256(1.30) | LDD3314 | [1] | |
Competitor(s) Related to This Target