Details of the Target
General Information of Target
Target ID | LDTP12990 | |||||
---|---|---|---|---|---|---|
Target Name | Spermatogenesis-associated protein 7 (SPATA7) | |||||
Gene Name | SPATA7 | |||||
Gene ID | 55812 | |||||
Synonyms |
HSD3; Spermatogenesis-associated protein 7; HSD-3.1; Spermatogenesis-associated protein HSD3 |
|||||
3D Structure | ||||||
Sequence |
MSHGPKQPGAAAAPAGGKAPGQHGGFVVTVKQERGEGPRAGEKGSHEEEPVKKRGWPKGK
KRKKILPNGPKAPVTGYVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPTEKQRYL DEAEREKQQYMKELRAYQQSEAYKMCTEKIQEKKIKKEDSSSGLMNTLLNGHKGGDCDGF STFDVPIFTEEFLDQNKAREAELRRLRKMNVAFEEQNAVLQRHTQSMSSARERLEQELAL EERRTLALQQQLQAVRQALTASFASLPVPGTGETPTLGTLDFYMARLHGAIERDPAQHEK LIVRIKEILAQVASEHL |
|||||
Target Bioclass |
Other
|
|||||
Subcellular location |
Cytoplasm, cytoskeleton, cilium axoneme
|
|||||
Function |
Involved in the maintenance of both rod and cone photoreceptor cells. It is required for recruitment and proper localization of RPGRIP1 to the photoreceptor connecting cilium (CC), as well as photoreceptor-specific localization of proximal CC proteins at the distal CC. Maintenance of protein localization at the photoreceptor-specific distal CC is essential for normal microtubule stability and to prevent photoreceptor degeneration.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C308(0.89) | LDD1511 | [1] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0281 | AC21 | HEK-293T | C308(1.09) | LDD1520 | [1] |
LDCM0289 | AC29 | HEK-293T | C308(1.00) | LDD1528 | [1] |
LDCM0298 | AC37 | HEK-293T | C308(1.29) | LDD1537 | [1] |
LDCM0307 | AC45 | HEK-293T | C308(1.00) | LDD1546 | [1] |
LDCM0312 | AC5 | HEK-293T | C308(0.88) | LDD1551 | [1] |
LDCM0316 | AC53 | HEK-293T | C308(1.07) | LDD1555 | [1] |
LDCM0325 | AC61 | HEK-293T | C308(1.14) | LDD1564 | [1] |
LDCM0248 | AKOS034007472 | HEK-293T | C308(0.89) | LDD1511 | [1] |
LDCM0409 | CL21 | HEK-293T | C308(1.02) | LDD1613 | [1] |
LDCM0422 | CL33 | HEK-293T | C308(1.02) | LDD1626 | [1] |
LDCM0435 | CL45 | HEK-293T | C308(1.07) | LDD1639 | [1] |
LDCM0448 | CL57 | HEK-293T | C308(1.08) | LDD1651 | [1] |
LDCM0461 | CL69 | HEK-293T | C308(1.05) | LDD1664 | [1] |
LDCM0475 | CL81 | HEK-293T | C308(1.14) | LDD1678 | [1] |
LDCM0484 | CL9 | HEK-293T | C308(1.23) | LDD1687 | [1] |
LDCM0488 | CL93 | HEK-293T | C308(1.01) | LDD1691 | [1] |