Details of the Target
General Information of Target
Target ID | LDTP12977 | |||||
---|---|---|---|---|---|---|
Target Name | GSK3B-interacting protein (GSKIP) | |||||
Gene Name | GSKIP | |||||
Gene ID | 51527 | |||||
Synonyms |
C14orf129; GSK3B-interacting protein; GSKIP; GSK3beta interaction protein |
|||||
3D Structure | ||||||
Sequence |
MAMASVKLLAGVLRKPDAWIGLWGVLRGTPSSYKLCTSWNRYLYFSSTKLRAPNYKTLFY
NIFSLRLPGLLLSPECIFPFSVRLKSNIRSTKSTKKSLQKVDEEDSDEESHHDEMSEQEE ELEDDPTVVKNYKDLEKAVQSFRYDVVLKTGLDIGRNKVEDAFYKGELRLNEEKLWKKSR TVKVGDTLDLLIGEDKEAGTETVMRILLKKVFEEKTESEKYRVVLRRWKSLKLPKKRMSK |
|||||
Target Bioclass |
Other
|
|||||
Family |
GSKIP family
|
|||||
Subcellular location |
Cytoplasm
|
|||||
Function |
A-kinase anchoring protein for GSK3B and PKA that regulates or facilitates their kinase activity towards their targets. The ternary complex enhances Wnt-induced signaling by facilitating the GSK3B- and PKA-induced phosphorylation of beta-catenin leading to beta-catenin degradation and stabilization respectively. Upon cAMP activation, the ternary complex contributes to neuroprotection against oxidative stress-induced apoptosis by facilitating the PKA-induced phosphorylation of DML1 and PKA-induced inactivation of GSK3B. During neurite outgrowth promotes neuron proliferation; while increases beta-catenin-induced transcriptional activity through GSK3B kinase activity inhibition, reduces N-cadherin level to promote cell cycle progression.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
IA-alkyne Probe Info |
![]() |
C59(5.10) | LDD2157 | [1] | |
DBIA Probe Info |
![]() |
C77(1.61) | LDD3325 | [2] | |
m-APA Probe Info |
![]() |
N.A. | LDD2232 | [3] | |
NAIA_5 Probe Info |
![]() |
C59(0.00); C77(0.00) | LDD2223 | [4] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0281 | AC21 | HEK-293T | C59(1.05) | LDD1520 | [5] |
LDCM0289 | AC29 | HEK-293T | C59(1.07) | LDD1528 | [5] |
LDCM0298 | AC37 | HEK-293T | C59(1.03) | LDD1537 | [5] |
LDCM0307 | AC45 | HEK-293T | C59(0.94) | LDD1546 | [5] |
LDCM0312 | AC5 | HEK-293T | C59(0.93) | LDD1551 | [5] |
LDCM0316 | AC53 | HEK-293T | C59(1.09) | LDD1555 | [5] |
LDCM0325 | AC61 | HEK-293T | C59(0.95) | LDD1564 | [5] |
LDCM0248 | AKOS034007472 | HEK-293T | C59(1.25) | LDD1511 | [5] |
LDCM0632 | CL-Sc | Hep-G2 | C59(20.00) | LDD2227 | [4] |
LDCM0409 | CL21 | HEK-293T | C59(1.03) | LDD1613 | [5] |
LDCM0422 | CL33 | HEK-293T | C59(0.96) | LDD1626 | [5] |
LDCM0435 | CL45 | HEK-293T | C59(0.97) | LDD1639 | [5] |
LDCM0448 | CL57 | HEK-293T | C59(1.72) | LDD1651 | [5] |
LDCM0461 | CL69 | HEK-293T | C59(1.06) | LDD1664 | [5] |
LDCM0475 | CL81 | HEK-293T | C59(1.43) | LDD1678 | [5] |
LDCM0484 | CL9 | HEK-293T | C59(0.94) | LDD1687 | [5] |
LDCM0488 | CL93 | HEK-293T | C59(1.16) | LDD1691 | [5] |
LDCM0022 | KB02 | A-375 | C77(1.48) | LDD2255 | [2] |
LDCM0023 | KB03 | A-375 | C77(1.76) | LDD2672 | [2] |
LDCM0024 | KB05 | UACC257 | C77(1.61) | LDD3325 | [2] |
References