Details of the Target
General Information of Target
| Target ID | LDTP12976 | |||||
|---|---|---|---|---|---|---|
| Target Name | Mitochondrial transcription rescue factor 1 (MTRES1) | |||||
| Gene Name | MTRES1 | |||||
| Gene ID | 51250 | |||||
| Synonyms |
C6orf203; Mitochondrial transcription rescue factor 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVE
NLPRTVIRGSQAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYEL PTDDDTYEEHRRDKARKQQQQHRLENLHGAMYT |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Mitochondrion matrix
|
|||||
| Function |
Mitochondrial RNA-binding protein involved in mitochondrial transcription regulation. Functions as a protective factor to maintain proper mitochondrial RNA level during stress. Acts at the transcription level and its protective function depends on its RNA binding ability. Part of a mitoribosome-associated quality control pathway that prevents aberrant translation by responding to interruptions during elongation. As heterodimer with MTRF, ejects the unfinished nascent chain and peptidyl transfer RNA (tRNA), respectively, from stalled ribosomes. Recruitment of mitoribosome biogenesis factors to these quality control intermediates suggests additional roles for MTRES1 and MTRF during mitoribosome rescue.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Probe 1 Probe Info |
![]() |
Y164(20.20) | LDD3495 | [1] | |

