Details of the Target
General Information of Target
| Target ID | LDTP12975 | |||||
|---|---|---|---|---|---|---|
| Target Name | E3 ubiquitin-protein ligase RNF181 (RNF181) | |||||
| Gene Name | RNF181 | |||||
| Gene ID | 51255 | |||||
| Synonyms |
E3 ubiquitin-protein ligase RNF181; EC 2.3.2.27; RING finger protein 181 |
|||||
| 3D Structure | ||||||
| Sequence |
MTEDSQRNFRSVYYEKVGFRGVEEKKSLEILLKDDRLDTEKLCTFSQRFPLPSMYRALVW
KVLLGILPPHHESHAKVMMYRKEQYLDVLHALKVVRFVSDATPQAEVYLRMYQLESGKLP RSPSFPLEPDDEVFLAIAKAMEEMVEDSVDCYWITRRFVNQLNTKYRDSLPQLPKAFEQY LNLEDGRLLTHLRMCSAAPKLPYDLWFKRCFAGCLPESSLQRVWDKVVSGSCKILVFVAV EILLTFKIKVMALNSAEKITKFLENIPQDSSDAIVSKAIDLWHKHCGTPVHSS |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
RNF181 family
|
|||||
| Function |
E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Catalyzes monoubiquitination of 26S proteasome subunit PSMC2/RPT1.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K137(7.14) | LDD0277 | [1] | |
|
BTD Probe Info |
![]() |
C116(1.11) | LDD2111 | [2] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0166 | [3] | |
|
IPM Probe Info |
![]() |
N.A. | LDD0025 | [4] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2224 | [5] | |
|
Phosphinate-6 Probe Info |
![]() |
N.A. | LDD0018 | [6] | |
|
W1 Probe Info |
![]() |
C113(0.00); C116(0.00) | LDD0236 | [7] | |
|
AOyne Probe Info |
![]() |
13.40 | LDD0443 | [8] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0632 | CL-Sc | Hep-G2 | C10(1.07) | LDD2227 | [5] |
| LDCM0518 | Nucleophilic fragment 22a | MDA-MB-231 | C116(1.11) | LDD2111 | [2] |
| LDCM0541 | Nucleophilic fragment 36 | MDA-MB-231 | C116(0.89) | LDD2134 | [2] |
| LDCM0554 | Nucleophilic fragment 7a | MDA-MB-231 | C116(0.50) | LDD2148 | [2] |
| LDCM0627 | NUDT7-COV-1 | HEK-293T | C10(0.84) | LDD2206 | [9] |
| LDCM0628 | OTUB2-COV-1 | HEK-293T | C10(0.99) | LDD2207 | [9] |
The Interaction Atlas With This Target
References








