Details of the Target
General Information of Target
| Target ID | LDTP12941 | |||||
|---|---|---|---|---|---|---|
| Target Name | Calcium-binding protein 1 (CABP1) | |||||
| Gene Name | CABP1 | |||||
| Gene ID | 9478 | |||||
| Synonyms |
Calcium-binding protein 1; CaBP1; Calbrain; Caldendrin |
|||||
| 3D Structure | ||||||
| Sequence |
MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLT
SDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEW APPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELK LMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVE YVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHY CESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCS KSKRS |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Subcellular location |
Cytoplasm, cell cortex; Cytoplasm, cytoskeleton
|
|||||
| Function |
Modulates calcium-dependent activity of inositol 1,4,5-triphosphate receptors (ITPRs)(). Inhibits agonist-induced intracellular calcium signaling. Enhances inactivation and does not support calcium-dependent facilitation of voltage-dependent P/Q-type calcium channels. Causes calcium-dependent facilitation and inhibits inactivation of L-type calcium channels by binding to the same sites as calmodulin in the C-terminal domain of CACNA1C, but has an opposite effect on channel function. Suppresses the calcium-dependent inactivation of CACNA1D. Inhibits TRPC5 channels. Prevents NMDA receptor-induced cellular degeneration. Required for the normal transfer of light signals through the retina.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C105(0.74) | LDD2252 | [1] | |
Competitor(s) Related to This Target