Details of the Target
General Information of Target
| Target ID | LDTP12901 | |||||
|---|---|---|---|---|---|---|
| Target Name | Grainyhead-like protein 1 homolog (GRHL1) |
|
||||
| Gene Name | GRHL1 | |||||
| Gene ID | 29841 | |||||
| Synonyms |
LBP32; MGR; TFCP2L2; Grainyhead-like protein 1 homolog; Mammalian grainyhead; NH32; Transcription factor CP2-like 2; Transcription factor LBP-32 |
|||||
| 3D Structure | ||||||
| Sequence |
MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQRDKIEDELEMTMVCHRPEGLEQLEAQTNFT
KRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFE DFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKED TPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Grh/CP2 family, Grainyhead subfamily
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Transcription factor involved in epithelial development. Binds directly to the consensus DNA sequence 5'-AACCGGTT-3'. Important regulator of DSG1 in the context of hair anchorage and epidermal differentiation, participates in the maintenance of the skin barrier. There is no genetic interaction with GRHL3, nor functional cooperativity due to diverse target gene selectivity during epithelia development. May play a role in regulating glucose homeostasis and insulin signaling.; [Isoform 1]: Functions as a transcription activator.; [Isoform 2]: May function as a repressor in tissues where both isoform 1 and isoform 2 are expressed.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C335(4.49) | LDD3319 | [1] | |
Competitor(s) Related to This Target