Details of the Target
General Information of Target
| Target ID | LDTP12897 | |||||
|---|---|---|---|---|---|---|
| Target Name | Interleukin-37 (IL37) |
|
||||
| Gene Name | IL37 | |||||
| Gene ID | 27178 | |||||
| Synonyms |
FIL1Z; IL1F7; IL1H4; IL1RP1; Interleukin-37; IL-37; FIL1 zeta; IL-1X; Interleukin-1 family member 7; IL-1F7; Interleukin-1 homolog 4; IL-1H; IL-1H4; Interleukin-1 zeta; IL-1 zeta; Interleukin-1-related protein; IL-1RP1
|
|||||
| 3D Structure | ||||||
| Sequence |
MFVASERKMRAHQVLTFLLLFVITSVASENASTSRGCGLDLLPQYVSLCDLDAIWGIVVE
AVAGAGALITLLLMLILLVRLPFIKEKEKKSPVGLHFLFLLGTLGLFGLTFAFIIQEDET ICSVRRFLWGVLFALCFSCLLSQAWRVRRLVRHGTGPAGWQLVGLALCLMLVQVIIAVEW LVLTVLRDTRPACAYEPMDFVMALIYDMVLLVVTLGLALFTLCGKFKRWKLNGAFLLITA FLSVLIWVAWMTMYLFGNVKLQQGDAWNDPTLAITLAASGWVFVIFHAIPEIHCTLLPAL QENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGFPNGSLGKRPS GSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAPPSHTGRHLW |
|||||
| Target Type |
Successful
|
|||||
| Target Bioclass |
Cytokine and receptor
|
|||||
| Family |
IL-1 family
|
|||||
| Subcellular location |
Cytoplasm, cytosol
|
|||||
| Function |
Immune regulatory cytokine that acts as a suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. Signaling can occur via two mechanisms, intracellularly through nuclear translocation with SMAD3 and extracellularly after secretion and binding to its receptor composed of IL18R1 and IL18RAP. Suppresses, or reduces, pro-inflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C207(3.37) | LDD3358 | [1] | |
Competitor(s) Related to This Target