Details of the Target
General Information of Target
| Target ID | LDTP12864 | |||||
|---|---|---|---|---|---|---|
| Target Name | Mitoferrin-1 (SLC25A37) | |||||
| Gene Name | SLC25A37 | |||||
| Gene ID | 51312 | |||||
| Synonyms |
MFRN; MSCP; Mitoferrin-1; Mitochondrial iron transporter 1; Mitochondrial solute carrier protein; Solute carrier family 25 member 37 |
|||||
| 3D Structure | ||||||
| Sequence |
MLQQDSNDDTEDVSLFDAEEETTNRPRKAKIRHPVASFFHLFFRVSAIIVYLLCGLLSSS
FITCMVTIILLLSCDFWAVKNVTGRLMVGLRWWNHIDEDGKSHWVFESRKESSQENKTVS EAESRIFWLGLIACPVLWVIFAFSALFSFRVKWLAVVIMGVVLQGANLYGYIRCKVRSRK HLTSMATSYFGKQFLRQNTGDDQTS |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Mitochondrial carrier (TC 2.A.29) family
|
|||||
| Subcellular location |
Mitochondrion inner membrane
|
|||||
| Function | Mitochondrial iron transporter that specifically mediates iron uptake in developing erythroid cells, thereby playing an essential role in heme biosynthesis. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
TFBX Probe Info |
 |
N.A. | LDD0148 | [1] | |
The Interaction Atlas With This Target