Details of the Target
General Information of Target
| Target ID | LDTP12829 | |||||
|---|---|---|---|---|---|---|
| Target Name | Potassium channel subfamily K member 4 (KCNK4) | |||||
| Gene Name | KCNK4 | |||||
| Gene ID | 50801 | |||||
| Synonyms |
TRAAK; Potassium channel subfamily K member 4; TWIK-related arachidonic acid-stimulated potassium channel protein; TRAAK; Two pore potassium channel KT4.1; Two pore K(+) channel KT4.1 |
|||||
| 3D Structure | ||||||
| Sequence |
MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCI
LKWLHAQQVQQHCPMCRQEWKFKE |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Two pore domain potassium channel (TC 1.A.1.8) family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Voltage-insensitive potassium channel. Channel opening is triggered by mechanical forces that deform the membrane. Channel opening is triggered by raising the intracellular pH to basic levels. The channel is inactive at 24 degrees Celsius (in vitro); raising the temperature to 37 degrees Celsius increases the frequency of channel opening, with a further increase in channel activity when the temperature is raised to 42 degrees Celsius. Plays a role in the perception of pain caused by heat. Plays a role in the sensory perception of pain caused by pressure.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
N.A. | LDD0175 | [1] | |
The Interaction Atlas With This Target