Details of the Target
General Information of Target
| Target ID | LDTP12808 | |||||
|---|---|---|---|---|---|---|
| Target Name | Protein AATF (AATF) | |||||
| Gene Name | AATF | |||||
| Gene ID | 26574 | |||||
| Synonyms |
CHE1; DED; Protein AATF; Apoptosis-antagonizing transcription factor; Rb-binding protein Che-1 |
|||||
| 3D Structure | ||||||
| Sequence |
MVLYTTPFPNSCLSALHCVSWALIFPCYWLVDRLAASFIPTTYEKRQRADDPCCLQLLCT
ALFTPIYLALLVASLPFAFLGFLFWSPLQSARRPYIYSRLEDKGLAGGAALLSEWKGTGP GKSFCFATANVCLLPDSLARVNNLFNTQARAKEIGQRIRNGAARPQIKIYIDSPTNTSIS AASFSSLVSPQGGDGVARAVPGSIKRTASVEYKGDGGRHPGDEAANGPASGDPVDSSSPE DACIVRIGGEEGGRPPEADDPVPGGQARNGAGGGPRGQTPNHNQQDGDSGSLGSPSASRE SLVKGRAGPDTSASGEPGANSKLLYKASVVKKAAARRRRHPDEAFDHEVSAFFPANLDFL CLQEVFDKRAATKLKEQLHGYFEYILYDVGVYGCQGCCSFKCLNSGLLFASRYPIMDVAY HCYPNKCNDDALASKGALFLKVQVGSTPQDQRIVGYIACTHLHAPQEDSAIRCGQLDLLQ DWLADFRKSTSSSSAANPEELVAFDVVCGDFNFDNCSSDDKLEQQHSLFTHYRDPCRLGP GEEKPWAIGTLLDTNGLYDEDVCTPDNLQKVLESEEGRREYLAFPTSKSSGQKGRKELLK GNGRRIDYMLHAEEGLCPDWKAEVEEFSFITQLSGLTDHLPVAMRLMVSSGEEEA |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
AATF family
|
|||||
| Subcellular location |
Nucleus, nucleolus
|
|||||
| Function |
Part of the small subunit (SSU) processome, first precursor of the small eukaryotic ribosomal subunit. During the assembly of the SSU processome in the nucleolus, many ribosome biogenesis factors, an RNA chaperone and ribosomal proteins associate with the nascent pre-rRNA and work in concert to generate RNA folding, modifications, rearrangements and cleavage as well as targeted degradation of pre-ribosomal RNA by the RNA exosome. May function as a general inhibitor of the histone deacetylase HDAC1. Binding to the pocket region of RB1 may displace HDAC1 from RB1/E2F complexes, leading to activation of E2F target genes and cell cycle progression. Conversely, displacement of HDAC1 from SP1 bound to the CDKN1A promoter leads to increased expression of this CDK inhibitor and blocks cell cycle progression. Also antagonizes PAWR mediated induction of aberrant amyloid peptide production in Alzheimer disease (presenile and senile dementia), although the molecular basis for this phenomenon has not been described to date.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
m-APA Probe Info |
![]() |
15.00 | LDD0402 | [1] | |
|
STPyne Probe Info |
![]() |
K375(10.00); K496(1.15) | LDD0277 | [2] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0222 | [3] | |
|
1c-yne Probe Info |
![]() |
N.A. | LDD0228 | [4] | |
|
1d-yne Probe Info |
![]() |
N.A. | LDD0357 | [4] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Amyloid-beta precursor protein (APP) | APP family | P05067 | |||
Transcription factor
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Meiosis-specific nuclear structural protein 1 (MNS1) | MNS1 family | Q8NEH6 | |||
| Neuroguidin (NGDN) | SAS10 family | Q8NEJ9 | |||
References





