Details of the Target
General Information of Target
| Target ID | LDTP12807 | |||||
|---|---|---|---|---|---|---|
| Target Name | Sphingomyelin phosphodiesterase 3 (SMPD3) |
|
||||
| Gene Name | SMPD3 | |||||
| Gene ID | 55512 | |||||
| Synonyms |
Sphingomyelin phosphodiesterase 3; EC 3.1.4.12; Neutral sphingomyelinase 2; nSMase-2; nSMase2; Neutral sphingomyelinase II |
|||||
| 3D Structure | ||||||
| Sequence |
MKTLFLGVTLGLAAALSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGG
NLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRG GLRYMGKLVGRNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Neutral sphingomyelinase family
|
|||||
| Subcellular location |
Golgi apparatus membrane
|
|||||
| Function |
Catalyzes the hydrolysis of sphingomyelin to form ceramide and phosphocholine. Ceramide mediates numerous cellular functions, such as apoptosis and growth arrest, and is capable of regulating these 2 cellular events independently. Also hydrolyzes sphingosylphosphocholine. Regulates the cell cycle by acting as a growth suppressor in confluent cells. Probably acts as a regulator of postnatal development and participates in bone and dentin mineralization. Binds to anionic phospholipids (APLs) such as phosphatidylserine (PS) and phosphatidic acid (PA) that modulate enzymatic activity and subcellular location. May be involved in IL-1-beta-induced JNK activation in hepatocytes. May act as a mediator in transcriptional regulation of NOS2/iNOS via the NF-kappa-B activation under inflammatory conditions.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
4-Iodoacetamidophenylacetylene Probe Info |
 |
C125(0.00); C132(0.00) | LDD0038 | [1] | |