Details of the Target
General Information of Target
Target ID | LDTP12797 | |||||
---|---|---|---|---|---|---|
Target Name | Stabilin-1 (STAB1) | |||||
Gene Name | STAB1 | |||||
Gene ID | 23166 | |||||
Synonyms |
FEEL1; KIAA0246; Stabilin-1; Fasciclin, EGF-like, laminin-type EGF-like and link domain-containing scavenger receptor 1; FEEL-1; MS-1 antigen |
|||||
3D Structure | ||||||
Sequence |
MSFRGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRGGFNK
GQDQGPPERVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQL RDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGRGGRGGGR GGGGRGGGRGGGFRGGRGGGGGGFRGGRGGGFRGRGH |
|||||
Target Type |
Literature-reported
|
|||||
Target Bioclass |
Transporter and channel
|
|||||
Subcellular location |
Membrane
|
|||||
Function |
Acts as a scavenger receptor for acetylated low density lipoprotein. Binds to both Gram-positive and Gram-negative bacteria and may play a role in defense against bacterial infection. When inhibited in endothelial tube formation assays, there is a marked decrease in cell-cell interactions, suggesting a role in angiogenesis. Involved in the delivery of newly synthesized CHID1/SI-CLP from the biosynthetic compartment to the endosomal/lysosomal system.
|
|||||
TTD ID | ||||||
Uniprot ID | ||||||
DrugMap ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C1260(1.22) | LDD3338 | [1] |
Competitor(s) Related to This Target