Details of the Target
General Information of Target
| Target ID | LDTP12759 | |||||
|---|---|---|---|---|---|---|
| Target Name | Huntingtin-interacting protein K (HYPK) | |||||
| Gene Name | HYPK | |||||
| Gene ID | 25764 | |||||
| Synonyms |
C15orf63; Huntingtin-interacting protein K; Huntingtin yeast partner K |
|||||
| 3D Structure | ||||||
| Sequence |
MAAVHDLEMESMNLNMGREMKEELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRG
TYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWITLDTGILESPFIYSPEKREEA WRFISYMLVHAGVQHILGNLCMQLVLGIPLEMVHKGLRVGLVYLAGVIAGSLASSIFDPL RYLVGASGGVYALMGGYFMNVLVNFQEMIPAFGIFRLLIIILIIVLDMGFALYRRFFVPE DGSPVSFAAHIAGGFAGMSIGYTVFSCFDKALLKDPRFWIAIAAYLACVLFAVFFNIFLS PAN |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Component of several N-terminal acetyltransferase complexes. Inhibits the N-terminal acetylation activity of the N-terminal acetyltransferase NAA10-NAA15 complex (also called the NatA complex). Has chaperone-like activity preventing polyglutamine (polyQ) aggregation of HTT in neuronal cells probably while associated with the NatA complex. May play a role in the NatA complex-mediated N-terminal acetylation of PCNP.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K35(6.33) | LDD0277 | [1] | |
|
Probe 1 Probe Info |
![]() |
Y41(52.26) | LDD3495 | [2] | |
|
5E-2FA Probe Info |
![]() |
N.A. | LDD2235 | [3] | |
|
ATP probe Probe Info |
![]() |
N.A. | LDD0199 | [4] | |
|
m-APA Probe Info |
![]() |
N.A. | LDD2231 | [3] | |
|
SF Probe Info |
![]() |
N.A. | LDD0028 | [5] | |
|
1c-yne Probe Info |
![]() |
N.A. | LDD0228 | [6] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [7] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| N-alpha-acetyltransferase 15, NatA auxiliary subunit (NAA15) | . | Q9BXJ9 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Huntingtin (HTT) | Huntingtin family | P42858 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Alpha-taxilin (TXLNA) | Taxilin family | P40222 | |||
| UPF0561 protein C2orf68 (C2orf68) | UPF0561 family | Q2NKX9 | |||
| Melanoma-associated antigen 1 (MAGEA1) | . | P43355 | |||
References








