Details of the Target
General Information of Target
| Target ID | LDTP12750 | |||||
|---|---|---|---|---|---|---|
| Target Name | tRNA selenocysteine 1-associated protein 1 (TRNAU1AP) | |||||
| Gene Name | TRNAU1AP | |||||
| Gene ID | 54952 | |||||
| Synonyms |
SECP43; TRSPAP1; tRNA selenocysteine 1-associated protein 1; SECp43; tRNA selenocysteine-associated protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MTQDRPLLAVQEALKKCFPVVEEQQGLWQSALRDCQPLLSSLSNLAEQLQAAQNLRFEDV
PALRAFPDLKERLRRKQLVAGDIVLDKLGERLAILLKVRDMVSSHVERVFQIYEQHADTV GIDAVLQPSAVSPSVADMLEWLQDIERHYRKSYLKRKYLLSSIQWGDLANIQALPKAWDR ISKDEHQDLVQDILLNVSFFLEE |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
RRM TRSPAP family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Involved in the early steps of selenocysteine biosynthesis and tRNA(Sec) charging to the later steps resulting in the cotranslational incorporation of selenocysteine into selenoproteins. Stabilizes the SECISBP2, EEFSEC and tRNA(Sec) complex. May be involved in the methylation of tRNA(Sec). Enhances efficiency of selenoproteins synthesis.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| COLO800 | SNV: p.S4G | . | |||
| LNCaP clone FGC | SNV: p.N194S | DBIA Probe Info | |||
| TC71 | SNV: p.P121H; p.C123S | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
![]() |
N.A. | LDD0241 | [1] | |
|
Probe 1 Probe Info |
![]() |
Y86(13.89) | LDD3495 | [2] | |
|
DBIA Probe Info |
![]() |
C48(1.41) | LDD3375 | [3] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
C157(0.00); C48(0.00) | LDD0038 | [4] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0036 | [4] | |
|
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [4] | |
|
TFBX Probe Info |
![]() |
N.A. | LDD0027 | [5] | |
|
Compound 10 Probe Info |
![]() |
N.A. | LDD2216 | [6] | |
|
AOyne Probe Info |
![]() |
15.00 | LDD0443 | [7] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [8] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Calreticulin (CALR) | Calreticulin family | P27797 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Survival motor neuron protein (SMN1; SMN2) | SMN family | Q16637 | |||
References










