Details of the Target
General Information of Target
| Target ID | LDTP12714 | |||||
|---|---|---|---|---|---|---|
| Target Name | Solute carrier family 52, riboflavin transporter, member 1 (SLC52A1) | |||||
| Gene Name | SLC52A1 | |||||
| Gene ID | 55065 | |||||
| Synonyms |
GPR172B; PAR2; RFT1; Solute carrier family 52, riboflavin transporter, member 1; Porcine endogenous retrovirus A receptor 2; PERV-A receptor 2; huPAR-2; Protein GPR172B; Riboflavin transporter 1; hRFT1
|
|||||
| 3D Structure | ||||||
| Sequence |
MESKEELAANNLNGENAQQENEGGEQAPTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVP
NFRWAIPNRHIEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDFCLIP |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Riboflavin transporter family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Plasma membrane transporter mediating the uptake by cells of the water soluble vitamin B2/riboflavin that plays a key role in biochemical oxidation-reduction reactions of the carbohydrate, lipid, and amino acid metabolism. Humans are unable to synthesize vitamin B2/riboflavin and must obtain it via intestinal absorption.; (Microbial infection) May function as a cell receptor to retroviral envelopes similar to the porcine endogenous retrovirus (PERV-A).
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C159(0.98) | LDD1492 | [1] | |
Competitor(s) Related to This Target