Details of the Target
General Information of Target
| Target ID | LDTP12654 | |||||
|---|---|---|---|---|---|---|
| Target Name | S-acyl fatty acid synthase thioesterase, medium chain (OLAH) | |||||
| Gene Name | OLAH | |||||
| Gene ID | 55301 | |||||
| Synonyms |
THEDC1; S-acyl fatty acid synthase thioesterase, medium chain; EC 3.1.2.14; Augmented in rheumatoid arthritis 1; AURA1; Oleoyl-ACP hydrolase; Thioesterase 2; TE2; Thioesterase II; Thioesterase domain-containing protein 1
|
|||||
| 3D Structure | ||||||
| Sequence |
MAGPRPRWRDQLLFMSIIVLVIVVICLMFYALLWEAGNLTDLPNLRIGFYNFCLWNEDTS
TLQCHQFPELEALGVPRVGLGLARLGVYGSLVLTLFAPQPLLLAQCNSDERAWRLAVGFL AVSSVLLAGGLGLFLSYVWKWVRLSLPGPGFLALGSAQALLILLLIAMAVFPLRAERAES KLESC |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Thioesterase family
|
|||||
| Subcellular location |
Cytoplasm, cytosol
|
|||||
| Function |
Contributes to the release of free fatty acids from fatty acid synthase (FASN). Has broad substrate specificity, giving rise to a range of free fatty acids with chain lengths between 10 and 16 carbon atoms (C10 - C16).
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C243(0.90) | LDD3480 | [1] | |
Competitor(s) Related to This Target

