General Information of Target

Target ID LDTP12634
Target Name Zinc transporter ZIP9 (SLC39A9)
Gene Name SLC39A9
Gene ID 55334
Synonyms
ZIP9; Zinc transporter ZIP9; Solute carrier family 39 member 9; Zrt- and Irt-like protein 9; ZIP-9
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MALTRPVRLFSLVTRLLLAPRRGLTVRSPDEPLPVVRIPVALQRQLEQRQSRRRNLPRPV
LVRPGPLLVSARRPELNQPARLTLGRWERAPLASQGWKSRRARRDHFSIERAQQEAPAVR
KLSSKGSFADLGLEPRVLHALQEAAPEVVQPTTVQSSTIPSLLRGRHVVCAAETGSGKTL
SYLLPLLQRLLGQPSLDSLPIPAPRGLVLVPSRELAQQVRAVAQPLGRSLGLLVRDLEGG
HGMRRIRLQLSRQPSADVLVATPGALWKALKSRLISLEQLSFLVLDEADTLLDESFLELV
DYILEKSHIAEGPADLEDPFNPKAQLVLVGATFPEGVGQLLNKVASPDAVTTITSSKLHC
IMPHVKQTFLRLKGADKVAELVHILKHRDRAERTGPSGTVLVFCNSSSTVNWLGYILDDH
KIQHLRLQGQMPALMRVGIFQSFQKSSRDILLCTDIASRGLDSTGVELVVNYDFPPTLQD
YIHRAGRVGRVGSEVPGTVISFVTHPWDVSLVQKIELAARRRRSLPGLASSVKEPLPQAT
Target Bioclass
Transporter and channel
Family
ZIP transporter (TC 2.A.5) family
Subcellular location
Golgi apparatus, trans-Golgi network membrane
Function
Transports zinc ions across cell and organelle membranes into the cytoplasm and regulates intracellular zinc homeostasis. Participates in the zinc ions efflux out of the secretory compartments. Regulates intracellular zinc level, resulting in the enhancement of AKT1 and MAPK3/MAPK1 (Erk1/2) phosphorylation in response to the BCR activation. Also functions as a membrane androgen receptor that mediates, through a G protein, the non-classical androgen signaling pathway, characterized by the activation of MAPK3/MAPK1 (Erk1/2) and transcription factors CREB1 or ATF1. This pathway contributes to CLDN1 and CLDN5 expression and tight junction formation between adjacent Sertoli cells. Mediates androgen-induced vascular endothelial cell proliferation through activation of an inhibitory G protein leading to the AKT1 and MAPK3/MAPK1 (Erk1/2) activation which in turn modulate inhibition (phosphorylation) of GSK3B and CCND1 transcription. Moreover, has dual functions as a membrane-bound androgen receptor and as an androgen-dependent zinc transporter both of which are mediated through an inhibitory G protein (Gi) that mediates both MAP kinase and zinc signaling leading to the androgen-dependent apoptotic process.
Uniprot ID
Q9NUM3
Ensemble ID
ENST00000336643.10
HGNC ID
HGNC:20182

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
COLO792 Substitution: p.T169V .
HCT116 SNV: p.L9P .
LS123 SNV: p.S8R .
MCC13 SNV: p.L62F .
MEWO SNV: p.L114P .
SW1271 SNV: p.H129Y .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
Acrolein
 Probe Info 
N.A.  LDD0222  [1]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0108  Chloroacetamide HeLa N.A.  LDD0222  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cytochrome b5 type B (CYB5B) Cytochrome b5 family O43169
Very long chain fatty acid elongase 5 (ELOVL5) ELO family Q9NYP7
Sialidase-1 (NEU1) Glycosyl hydrolase 33 family Q99519
Glutathione S-transferase 3, mitochondrial (MGST3) MAPEG family O14880
Lysoplasmalogenase TMEM86B (TMEM86B) TMEM86 family Q8N661
BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 (BNIP2) . Q12982
Ceramide synthase 3 (CERS3) . Q8IU89
Transporter and channel
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
High affinity cationic amino acid transporter 1 (SLC7A1) Cationic amino acid transporter (CAT) (TC 2.A.3.3) family P30825
Gamma-secretase subunit APH-1A (APH1A) APH-1 family Q96BI3
Sodium-dependent organic anion transporter (SLC10A6) Bile acid:sodium symporter (BASS) family Q3KNW5
Gap junction alpha-8 protein (GJA8) Connexin family P48165
Transmembrane 4 L6 family member 18 (TM4SF18) L6 tetraspanin family Q96CE8
Hippocampus abundant transcript-like protein 1 (MFSD14B) Major facilitator superfamily Q5SR56
Molybdate-anion transporter (MFSD5) Major facilitator superfamily Q6N075
Aquaporin-6 (AQP6) MIP/aquaporin (TC 1.A.8) family Q13520
Vacuole membrane protein 1 (VMP1) VMP1 family Q96GC9
Zinc transporter ZIP2 (SLC39A2) ZIP transporter (TC 2.A.5) family Q9NP94
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclic AMP-responsive element-binding protein 3-like protein 1 (CREB3L1) BZIP family Q96BA8
Cyclic AMP-responsive element-binding protein 3-like protein 3 (CREB3L3) BZIP family Q68CJ9
GPCR
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
5-hydroxytryptamine receptor 2C (HTR2C) G-protein coupled receptor 1 family P28335
Free fatty acid receptor 2 (FFAR2) G-protein coupled receptor 1 family O15552
Probable G-protein coupled receptor 101 (GPR101) G-protein coupled receptor 1 family Q96P66
Thyrotropin-releasing hormone receptor (TRHR) G-protein coupled receptor 1 family P34981
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
B-cell antigen receptor complex-associated protein alpha chain (CD79A) . P11912
Other
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Complexin-4 (CPLX4) Complexin/synaphin family Q7Z7G2
Receptor-transporting protein 2 (RTP2) TMEM7 family Q5QGT7
Protein MANBAL (MANBAL) UPF0239 family Q9NQG1
Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein (HERPUD2) . Q9BSE4
Serine-rich single-pass membrane protein 1 (SSMEM1) . Q8WWF3
Transmembrane protein 140 (TMEM140) . Q9NV12

The Drug(s) Related To This Target

Approved
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Zinc Chloride . DB14533
Zinc Sulfate Unspecified Form . DB14548

References

1 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.