Details of the Target
General Information of Target
| Target ID | LDTP12632 | |||||
|---|---|---|---|---|---|---|
| Target Name | Shiftless antiviral inhibitor of ribosomal frameshifting protein (SHFL) | |||||
| Gene Name | SHFL | |||||
| Gene ID | 55337 | |||||
| Synonyms |
C19orf66; FLJ11286; IRAV; RYDEN; SFL; Shiftless antiviral inhibitor of ribosomal frameshifting protein; SFL; SHFL; Interferon-regulated antiviral protein; IRAV; Repressor of yield of DENV protein; RyDEN
|
|||||
| 3D Structure | ||||||
| Sequence |
MANPKEKTAMCLVNELARFNRVQPQYKLLNERGPAHSKMFSVQLSLGEQTWESEGSSIKK
AQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKP FPNYRANYNFRGMYNQRYHCPVPKIFYVQLTVGNNEFFGEGKTRQAARHNAAMKALQALQ NEPIPERSPQNGESGKDVDDDKDANKSEISLVFEIALKRNMPVSFEVIKESGPPHMKSFV TRVSVGEFSAEGEGNSKKLSKKRAATTVLQELKKLPPLPVVEKPKLFFKKRPKTIVKAGP EYGQGMNPISRLAQIQQAKKEKEPDYVLLSERGMPRRREFVMQVKVGNEVATGTGPNKKI AKKNAAEAMLLQLGYKASTNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGILHLSPDVY QEMEASRHKVISGTTLGYLSPKDMNQPSSSFFSISPTSNSSATIARELLMNGTSSTAEAI GLKGSSPTPPCSPVQPSKQLEYLARIQGFQAALSALKQFSEQGLDPIDGAMNIEKGSLEK QAKHLREKADNNQAPPGSIAQDCKKSNSAV |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
SHFL family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Inhibits programmed -1 ribosomal frameshifting (-1PRF) of a variety of mRNAs from viruses, such as HIV1, and cellular genes, such as PEG10. Interacts with the -1PRF signal of target mRNA and translating ribosomes and causes premature translation termination at the frameshifting site. Regulates HIV1 GAG-POL expression by inhibiting -1PRF. Exhibits antiviral activity against dengue virus (DENV) and can inhibit the replication of all DENV serotypes. May block the protein translation of DENV RNA via its association with cellular mRNA-binding proteins and viral RNA. Interrupts also Zika virus replication by promoting viral NS3 degradation via a lysosome-dependent pathway. Can also limit the replication of hepatitis C virus (HCV) by restricting formation of viral replication organelle, West Nile virus (WNV), Chikungunya virus (CHIKV), herpes simplex virus type 1 (HHV-1), herpes virus type 8 (HHV-8) and human adenovirus. Binds nucleic acids with a higher affinity for ssRNA and ssDNA than for dsDNA.; Isoform 4 does not inhibit programmed ribosomal frameshifting (-1PRF). Does not bind to ribosomes.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K230(7.69) | LDD0277 | [1] | |
|
DBIA Probe Info |
![]() |
C155(1.03) | LDD3427 | [2] | |
|
IA-alkyne Probe Info |
![]() |
C210(0.00); C205(0.00) | LDD2241 | [3] | |
Competitor(s) Related to This Target
References



