Details of the Target
General Information of Target
| Target ID | LDTP12576 | |||||
|---|---|---|---|---|---|---|
| Target Name | Potassium voltage-gated channel subfamily D member 1 (KCND1) | |||||
| Gene Name | KCND1 | |||||
| Gene ID | 3750 | |||||
| Synonyms |
Potassium voltage-gated channel subfamily D member 1; Voltage-gated potassium channel subunit Kv4.1 |
|||||
| 3D Structure | ||||||
| Sequence |
MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAH
LEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA CSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGI LAPQPPDVGSSDPLSMVGPSQGRSPSYAS |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Potassium channel family, D (Shal) (TC 1.A.1.2) subfamily, Kv4.1/KCND1 sub-subfamily
|
|||||
| Subcellular location |
Membrane
|
|||||
| Function |
Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May contribute to I(To) current in heart and I(Sa) current in neurons. Channel properties are modulated by interactions with other alpha subunits and with regulatory subunits.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C233(0.15); C238(0.15) | LDD2214 | [1] | |
Competitor(s) Related to This Target

