Details of the Target
General Information of Target
Target ID | LDTP12549 | |||||
---|---|---|---|---|---|---|
Target Name | Phospholipid scramblase 2 (PLSCR2) | |||||
Gene Name | PLSCR2 | |||||
Gene ID | 57047 | |||||
Synonyms |
Phospholipid scramblase 2; PL scramblase 2; Ca(2+)-dependent phospholipid scramblase 2 |
|||||
3D Structure | ||||||
Sequence |
MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVAL
GSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAA EESNCCARLCCGARRPLRVRLADPGDREVLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTI GHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQW GGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAVTS |
|||||
Target Bioclass |
Transporter and channel
|
|||||
Family |
Phospholipid scramblase family
|
|||||
Subcellular location |
Membrane; Nucleus
|
|||||
Function |
May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.; Isoform 1 has no prospholipid scramblase activity, due to the lack of a N-terminal proline-rich domain.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
IA-alkyne Probe Info |
![]() |
C227(0.27) | LDD2207 | [1] | |
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [2] | |
Methacrolein Probe Info |
![]() |
N.A. | LDD0218 | [2] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Aquaporin-1 (AQP1) | MIP/aquaporin (TC 1.A.8) family | P29972 | |||
Barttin (BSND) | . | Q8WZ55 |
Transcription factor
Other
References