Details of the Target
General Information of Target
| Target ID | LDTP12546 | |||||
|---|---|---|---|---|---|---|
| Target Name | SOSS complex subunit C (INIP) | |||||
| Gene Name | INIP | |||||
| Gene ID | 58493 | |||||
| Synonyms |
C9orf80; SSBIP1; SOSS complex subunit C; INTS3- and NABP-interacting protein; Sensor of single-strand DNA complex subunit C; Sensor of ssDNA subunit C; SOSS-C; Single-stranded DNA-binding protein-interacting protein 1; SSB-interacting protein 1; hSSBIP1
|
|||||
| 3D Structure | ||||||
| Sequence |
MTNVYSLDGILVFGLLFVCTCAYFKKVPRLKTWLLSEKKGVWGVFYKAAVIGTRLHAAVA
IACVVMAFYVLFIK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
SOSS-C family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. The SOSS complex associates with single-stranded DNA at DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
 |
K24(3.70); K26(10.00) | LDD0277 | [1] | |
|
5E-2FA Probe Info |
 |
H63(0.00); H39(0.00) | LDD2235 | [2] | |
|
m-APA Probe Info |
 |
H63(0.00); H39(0.00) | LDD2231 | [2] | |
References