Details of the Target
General Information of Target
| Target ID | LDTP12536 | |||||
|---|---|---|---|---|---|---|
| Target Name | Transmembrane protease serine 4 (TMPRSS4) | |||||
| Gene Name | TMPRSS4 | |||||
| Gene ID | 56649 | |||||
| Synonyms |
TMPRSS3; Transmembrane protease serine 4; EC 3.4.21.-; Channel-activating protease 2; CAPH2; Membrane-type serine protease 2; MT-SP2) [Cleaved into: Transmembrane protease serine 4 catalytic chain] |
|||||
| 3D Structure | ||||||
| Sequence |
MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQ
EQMRSKGNRDRPWSNSRGL |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Peptidase S1 family
|
|||||
| Subcellular location |
Secreted; Cell membrane
|
|||||
| Function |
Plasma membrane-anchored serine protease that directly induces processing of pro-uPA/PLAU into the active form through proteolytic activity. Seems to be capable of activating ENaC.; (Microbial infection) In gut epithelial cells, facilitates human coronavirus SARS-CoV-2 infection through, at least, the cleavage of coronavirus spike glycoproteins which activates the glycoprotein for host cell entry.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
N.A. | LDD0162 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Probable glutathione peroxidase 8 (GPX8) | Glutathione peroxidase family | Q8TED1 | |||
Transporter and channel
Immunoglobulin
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Sialic acid-binding Ig-like lectin 12 (SIGLEC12) | SIGLEC (sialic acid binding Ig-like lectin) family | Q96PQ1 | |||
Other