Details of the Target
General Information of Target
| Target ID | LDTP12530 | |||||
|---|---|---|---|---|---|---|
| Target Name | Tryptase gamma (TPSG1) | |||||
| Gene Name | TPSG1 | |||||
| Gene ID | 25823 | |||||
| Synonyms |
PRSS31; TMT; Tryptase gamma; EC 3.4.21.-; Serine protease 31; Transmembrane tryptase) [Cleaved into: Tryptase gamma light chain; Tryptase gamma heavy chain] |
|||||
| 3D Structure | ||||||
| Sequence |
MRQLKGKPKKETSKDKKERKQAMQEARQQITTVVLPTLAVVVLLIVVFVYVATRPTITE
|
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Peptidase S1 family, Tryptase subfamily
|
|||||
| Subcellular location |
Membrane
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0165 | [1] | |
The Interaction Atlas With This Target

