Details of the Target
General Information of Target
Target ID | LDTP12487 | |||||
---|---|---|---|---|---|---|
Target Name | Toll-like receptor 9 (TLR9) | |||||
Gene Name | TLR9 | |||||
Gene ID | 54106 | |||||
Synonyms |
Toll-like receptor 9; CD antigen CD289 |
|||||
3D Structure | ||||||
Sequence |
MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCF
GRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLC ARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQAYSAYPHSPGQVIT GCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTAGYQLPVYNYQAF PAYPNSPFQVATGYQFPVYNYQPFPAYPSSPFQVTAGYQLPVYNYQAFPAYPNSPFQVAT GYQFPVYNYQAFPAYPNSPVQVTTGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAF PAYPNSPVQVTTGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAFPAYPNSPVQVTT GYQLPVYNYQAFPAYPNSAVQVTTGYQFHVYNYQMPPQCPVGEQRRNLWTEAYKWWYLVC LIQRRD |
|||||
Target Type |
Clinical trial
|
|||||
Target Bioclass |
Other
|
|||||
Family |
Toll-like receptor family
|
|||||
Subcellular location |
Endoplasmic reticulum membrane
|
|||||
Function |
Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR9 is a nucleotide-sensing TLR which is activated by unmethylated cytidine-phosphate-guanosine (CpG) dinucleotides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Controls lymphocyte response to Helicobacter infection. Upon CpG stimulation, induces B-cell proliferation, activation, survival and antibody production.
|
|||||
TTD ID | ||||||
Uniprot ID | ||||||
DrugMap ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Target Site Mutations in Different Cell Lines
Cell line | Mutation details | Probe for labeling this protein in this cell | |||
---|---|---|---|---|---|
A2780 | SNV: p.Q998H | . | |||
AGS | SNV: p.P100Q | . | |||
CHL1 | SNV: p.H9N | . | |||
COLO792 | Deletion: p.L289QfsTer24 | . | |||
COLO829 | SNV: p.G514S | . | |||
HCT15 | SNV: p.S569T; p.R899H | . | |||
HT | SNV: p.D551G | DBIA Probe Info | |||
HT115 | SNV: p.F56L | . | |||
Ishikawa (Heraklio) 02 ER | SNV: p.P558H | . | |||
JURKAT | SNV: p.R481Q | . | |||
K562 | SNV: p.R311Ter | . | |||
LN229 | SNV: p.M392I | . | |||
LNCaP clone FGC | SNV: p.Q331H | . | |||
MCC13 | SNV: p.G442E | . | |||
MELJUSO | SNV: p.F517S | . | |||
MOLT4 | SNV: p.R931C | . | |||
NCIH358 | SNV: p.D842G | . | |||
SKMEL3 | SNV: p.D842G | . | |||
SW1116 | SNV: p.V591L | . |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
IPM Probe Info |
![]() |
N.A. | LDD0241 | [1] | |
DBIA Probe Info |
![]() |
C279(3.17) | LDD3408 | [2] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0214 | AC1 | HEK-293T | C255(0.90) | LDD1507 | [3] |
LDCM0226 | AC11 | HEK-293T | C255(0.99) | LDD1509 | [3] |
LDCM0276 | AC17 | HEK-293T | C255(0.79) | LDD1515 | [3] |
LDCM0278 | AC19 | HEK-293T | C255(1.04) | LDD1517 | [3] |
LDCM0285 | AC25 | HEK-293T | C255(0.81) | LDD1524 | [3] |
LDCM0287 | AC27 | HEK-293T | C255(1.10) | LDD1526 | [3] |
LDCM0290 | AC3 | HEK-293T | C255(1.03) | LDD1529 | [3] |
LDCM0294 | AC33 | HEK-293T | C255(0.92) | LDD1533 | [3] |
LDCM0296 | AC35 | HEK-293T | C255(1.08) | LDD1535 | [3] |
LDCM0303 | AC41 | HEK-293T | C255(0.79) | LDD1542 | [3] |
LDCM0305 | AC43 | HEK-293T | C255(1.12) | LDD1544 | [3] |
LDCM0311 | AC49 | HEK-293T | C255(0.84) | LDD1550 | [3] |
LDCM0314 | AC51 | HEK-293T | C255(1.02) | LDD1553 | [3] |
LDCM0320 | AC57 | HEK-293T | C255(0.93) | LDD1559 | [3] |
LDCM0322 | AC59 | HEK-293T | C255(1.06) | LDD1561 | [3] |
LDCM0356 | AKOS034007680 | HEK-293T | C255(0.93) | LDD1570 | [3] |
LDCM0404 | CL17 | HEK-293T | C255(1.00) | LDD1608 | [3] |
LDCM0406 | CL19 | HEK-293T | C255(1.15) | LDD1610 | [3] |
LDCM0417 | CL29 | HEK-293T | C255(0.80) | LDD1621 | [3] |
LDCM0420 | CL31 | HEK-293T | C255(1.01) | LDD1624 | [3] |
LDCM0431 | CL41 | HEK-293T | C255(0.88) | LDD1635 | [3] |
LDCM0433 | CL43 | HEK-293T | C255(1.07) | LDD1637 | [3] |
LDCM0440 | CL5 | HEK-293T | C255(0.93) | LDD1644 | [3] |
LDCM0444 | CL53 | HEK-293T | C255(0.91) | LDD1647 | [3] |
LDCM0446 | CL55 | HEK-293T | C255(0.98) | LDD1649 | [3] |
LDCM0457 | CL65 | HEK-293T | C255(0.94) | LDD1660 | [3] |
LDCM0459 | CL67 | HEK-293T | C255(1.08) | LDD1662 | [3] |
LDCM0462 | CL7 | HEK-293T | C255(1.04) | LDD1665 | [3] |
LDCM0470 | CL77 | HEK-293T | C255(0.91) | LDD1673 | [3] |
LDCM0472 | CL79 | HEK-293T | C255(1.05) | LDD1675 | [3] |
LDCM0483 | CL89 | HEK-293T | C255(1.11) | LDD1686 | [3] |
LDCM0486 | CL91 | HEK-293T | C255(0.98) | LDD1689 | [3] |
LDCM0022 | KB02 | A3-KAW | C279(1.76) | LDD2257 | [2] |
LDCM0023 | KB03 | Karpas-422 | C279(3.95) | LDD2830 | [2] |
LDCM0024 | KB05 | RL | C279(3.17) | LDD3408 | [2] |
The Interaction Atlas With This Target
The Drug(s) Related To This Target
Approved
Drug Name | Drug Type | External ID | |||
---|---|---|---|---|---|
Chloroquine | Small molecular drug | DB00608 | |||
Hydroxychloroquine | Small molecular drug | DB01611 |
Phase 3
Drug Name | Drug Type | External ID | |||
---|---|---|---|---|---|
Sd-101 | Oligonucleotide | D08RJM | |||
Tilsotolimod | Oligonucleotide | D6YD0X | |||
Cadi-05 | Vaccine | D0V0JR | |||
Imo-2125 | . | D0FM5M | |||
Mgn-1703 | . | D0F7YW |
Phase 2
Phase 1
Preclinical
Drug Name | Drug Type | External ID | |||
---|---|---|---|---|---|
Imo-2134 | . | D02ZWR |
Investigative
Drug Name | Drug Type | External ID | |||
---|---|---|---|---|---|
Odn-2088 | Oligonucleotide | DT6N0O | |||
Cov08-0064 | Small molecular drug | DX45IW | |||
Golotimod | Small molecular drug | DB05475 | |||
Cpg 10101 | . | DB05530 | |||
Dims-9054 | . | D0Q2UW | |||
Iss-1018 | . | DB05463 |
Discontinued
Drug Name | Drug Type | External ID | |||
---|---|---|---|---|---|
Ir-103 | Vaccine | D03GAI | |||
Agatolimod | . | D0D5FQ | |||
Ave0675 | . | D0B6WN | |||
Im0-8400 | . | D0H4XV |
References