Details of the Target
General Information of Target
| Target ID | LDTP12408 | |||||
|---|---|---|---|---|---|---|
| Target Name | APOBEC1 complementation factor (A1CF) | |||||
| Gene Name | A1CF | |||||
| Gene ID | 29974 | |||||
| Synonyms |
ACF; ASP; APOBEC1 complementation factor; APOBEC1-stimulating protein |
|||||
| 3D Structure | ||||||
| Sequence |
MDLQAAGAQAQGAAEPSRGPPLPSARGAPPSPEAGFATADHSSQERETEKAMDRLARGTQ
SIPNDSPARGEGTHSEEEGFAMDEEDSDGELNTWELSEGTNCPPKEQPGDLFNEDWDSEL KADQGNPYDADDIQESISQELKPWVCCAPQGDMIYDPSWHHPPPLIPYYSKMVFETGQFD DAED |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Essential component of the apolipoprotein B mRNA editing enzyme complex which is responsible for the postranscriptional editing of a CAA codon for Gln to a UAA codon for stop in APOB mRNA. Binds to APOB mRNA and is probably responsible for docking the catalytic subunit, APOBEC1, to the mRNA to allow it to deaminate its target cytosine. The complex also protects the edited APOB mRNA from nonsense-mediated decay.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
![]() |
C455(0.00); C130(0.00); C136(0.00); C56(0.00) | LDD0241 | [1] | |
|
DBIA Probe Info |
![]() |
C64(9.47) | LDD3380 | [2] | |
|
W1 Probe Info |
![]() |
C455(0.00); C76(0.00) | LDD0236 | [1] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Methyltransferase-like protein 27 (METTL27) | . | Q8N6F8 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Pogo transposable element with ZNF domain (POGZ) | . | Q7Z3K3 | |||
| Proto-oncogene c-Rel (REL) | . | Q04864 | |||
Other
References



