Details of the Target
General Information of Target
| Target ID | LDTP12391 | |||||
|---|---|---|---|---|---|---|
| Target Name | Signal peptide, CUB and EGF-like domain-containing protein 2 (SCUBE2) | |||||
| Gene Name | SCUBE2 | |||||
| Gene ID | 57758 | |||||
| Synonyms |
CEGP1; Signal peptide, CUB and EGF-like domain-containing protein 2; Protein CEGP1; Scube/You |
|||||
| 3D Structure | ||||||
| Sequence |
MDNCLAAAALNGVDRRSLQRSARLALEVLERAKRRAVDWHALERPKGCMGVLAREAPHLE
KQPAAGPQRVLPGEREERPPTLSASFRTMAEFMDYTSSQCGKYYSSVPEEGGATHVYRYH RGESKLHMCLDIGNGQRKDRKKTSLGPGGSYQISEHAPEASQPAENISKDLYIEVYPGTY SVTVGSNDLTKKTHVVAVDSGQSVDLVFPV |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Lipid-binding protein required for SHH long-range signaling by binding to the dually lipid-modified SHH (ShhNp) and by promoting ShhNp mobilization, solubilization and release from the cell membrane. Acts by enhancing the proteolytic processing (shedding) of the lipid-modified N- and C- terminal of ShhNp at the cell surface. Synergizes with DISP1 to increase SHH secretion. Probable cell surface coreceptor for VEGFR2 involved in VEGFR2-mediated angiogenesis.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
![]() |
N.A. | LDD0241 | [1] | |
|
DBIA Probe Info |
![]() |
C177(1.82) | LDD2269 | [2] | |
|
IA-alkyne Probe Info |
![]() |
C442(19.60) | LDD0315 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0022 | KB02 | BRX250 | C177(1.82) | LDD2269 | [2] |
| LDCM0023 | KB03 | Jurkat | C442(19.60) | LDD0315 | [3] |
| LDCM0024 | KB05 | BRX250 | C177(1.61) | LDD3103 | [2] |
| LDCM0627 | NUDT7-COV-1 | HEK-293T | C442(0.07) | LDD2206 | [4] |
| LDCM0628 | OTUB2-COV-1 | HEK-293T | C442(0.07) | LDD2207 | [4] |
References



