Details of the Target
General Information of Target
| Target ID | LDTP12380 | |||||
|---|---|---|---|---|---|---|
| Target Name | NLR family CARD domain-containing protein 4 (NLRC4) | |||||
| Gene Name | NLRC4 | |||||
| Gene ID | 58484 | |||||
| Synonyms |
CARD12; CLAN; CLAN1; IPAF; NLR family CARD domain-containing protein 4; CARD, LRR, and NACHT-containing protein; CED-4-like protein Clan; Caspase recruitment domain-containing protein 12; Ice protease-activating factor; Ipaf
|
|||||
| 3D Structure | ||||||
| Sequence |
MEVPPPAPRSFLCRALCLFPRVFAAEAVTADSEVLEERQKRLPYVPEPYYPESGWDRLRE
LFGKDEQQRISKDLANICKTAATAGIIGWVYGGIPAFIHAKQQYIEQSQAEIYHNRFDAV QSAHRAATRGFIRYGWRWGWRTAVFVTIFNTVNTSLNVYRNKDALSHFVIAGAVTGSLFR INVGLRGLVAGGIIGALLGTPVGGLLMAFQKYSGETVQERKQKDRKALHELKLEEWKGRL QVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDKD |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Key component of inflammasomes that indirectly senses specific proteins from pathogenic bacteria and fungi and responds by assembling an inflammasome complex that promotes caspase-1 activation, cytokine production and macrophage pyroptosis. The NLRC4 inflammasome is activated as part of the innate immune response to a range of intracellular bacteria.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [1] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target

