Details of the Target
General Information of Target
| Target ID | LDTP12342 | |||||
|---|---|---|---|---|---|---|
| Target Name | Lactosylceramide 4-alpha-galactosyltransferase (A4GALT) | |||||
| Gene Name | A4GALT | |||||
| Gene ID | 53947 | |||||
| Synonyms |
A14GALT; A4GALT1; Lactosylceramide 4-alpha-galactosyltransferase; EC 2.4.1.228; Alpha-1,4-N-acetylglucosaminyltransferase; Alpha-1,4-galactosyltransferase; Alpha4Gal-T1; CD77 synthase; Globotriaosylceramide synthase; Gb3 synthase; P1/Pk synthase; UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase
|
|||||
| 3D Structure | ||||||
| Sequence |
MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNSTLSGKLD
IVRTELSPSEEYKAMVLAGLRPEIVLDISSRALAFWTYQVHQERLYQEYNFSKAEGHLKQ MEKIYTQQIQSKDVELTSMKGEVTSMKKVLEEYKKKFSDISEKLMERNRQYQKLQGLYDS LRLRNITIANHEGTLEPSMIAQSGVLGFPLGNNSKFPLDNTPVRNRGDGDGDFQFRPFFA GSPTAPEPSNSFFSFVSPSRELEQQQVSSRAFKVKRI |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Glycosyltransferase 32 family
|
|||||
| Subcellular location |
Golgi apparatus membrane
|
|||||
| Function |
Catalyzes the transfer of galactose from UDP-alpha-D-galactose to lactosylceramide/beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-ceramide(d18:1(4E)) to produce globotriaosylceramide/globoside Gb3Cer (d18:1(4E)). Also able to transfer galactose to galactosylceramide/beta-D-Gal-(1<->1')-Cer. Globoside Gb3Cer is a glycosphingolipid of the globo serie, one of the major types of neutral root structures of glycosphingolipids, that constitute a significant portion of mammalian cell membranes (Probable). Globotriaosylceramide/globoside Gb3Cer in blood and tissue cell membranes is the antigen Pk of blood histogroup P.; (Microbial infection) Globotriaosylceramide is one of the cellular ligands for bacterial verotoxins.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C342(1.17) | LDD3360 | [1] | |
Competitor(s) Related to This Target

