Details of the Target
General Information of Target
| Target ID | LDTP12328 | |||||
|---|---|---|---|---|---|---|
| Target Name | Dynein light chain roadblock-type 1 (DYNLRB1) | |||||
| Gene Name | DYNLRB1 | |||||
| Gene ID | 83658 | |||||
| Synonyms |
BITH; DNCL2A; DNLC2A; ROBLD1; Dynein light chain roadblock-type 1; Bithoraxoid-like protein; BLP; Dynein light chain 2A, cytoplasmic; Dynein-associated protein Km23; Roadblock domain-containing protein 1
|
|||||
| 3D Structure | ||||||
| Sequence |
MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHL
HGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG MNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGAR SKRHQKFTHFLPRPVDPERVPELYKDLLMYT |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
GAMAD family
|
|||||
| Subcellular location |
Cytoplasm, cytoskeleton
|
|||||
| Function |
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K31(2.26) | LDD2217 | [1] | |
|
AZ-9 Probe Info |
![]() |
D59(10.00); D65(10.00) | LDD2208 | [2] | |
|
HHS-465 Probe Info |
![]() |
Y42(2.57) | LDD2237 | [3] | |
|
5E-2FA Probe Info |
![]() |
N.A. | LDD2235 | [4] | |
|
ATP probe Probe Info |
![]() |
N.A. | LDD0199 | [5] | |
|
1d-yne Probe Info |
![]() |
N.A. | LDD0358 | [6] | |
|
1c-yne Probe Info |
![]() |
N.A. | LDD0228 | [6] | |
The Interaction Atlas With This Target
References







