Details of the Target
General Information of Target
| Target ID | LDTP12316 | |||||
|---|---|---|---|---|---|---|
| Target Name | ABC-type oligopeptide transporter ABCB9 (ABCB9) | |||||
| Gene Name | ABCB9 | |||||
| Gene ID | 23457 | |||||
| Synonyms |
KIAA1520; ABC-type oligopeptide transporter ABCB9; EC 7.4.2.6; ATP-binding cassette sub-family B member 9; ATP-binding cassette transporter 9; ABC transporter 9 protein; hABCB9; TAP-like protein; TAPL |
|||||
| 3D Structure | ||||||
| Sequence |
MPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTT
YDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVV EDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFE EKSGRTFLHTVCFY |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
ABC transporter superfamily, ABCB family, MHC peptide exporter (TC 3.A.1.209) subfamily
|
|||||
| Subcellular location |
Lysosome membrane
|
|||||
| Function |
ATP-dependent low-affinity peptide transporter which translocates a broad spectrum of peptides from the cytosol to the lysosomal lumen for degradation. Displays a broad peptide length specificity from 6-mer up to at least 59-mer peptides with an optimum of 23-mers. Binds and transports smaller and larger peptides with the same affinity. Favors positively charged, aromatic or hydrophobic residues in the N- and C-terminal positions whereas negatively charged residues as well as asparagine and methionine are not favored.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
ATP probe Probe Info |
![]() |
N.A. | LDD0199 | [1] | |

