Details of the Target
General Information of Target
| Target ID | LDTP12295 | |||||
|---|---|---|---|---|---|---|
| Target Name | HERV-H_2q24.3 provirus ancestral Env polyprotein | |||||
| Synonyms |
HERV-H_2q24.3 provirus ancestral Env polyprotein; Env protein HERV-H/p62; Env protein HERV-H19; Env protein HERV-Hcl.3; Envelope polyprotein; HERV-H/env62) [Cleaved into: Surface protein; SU; Transmembrane protein; TM)]
|
|||||
| 3D Structure | ||||||
| Sequence |
MAFNDCFSLNYPGNPCPGDLIEVFRPGYQHWALYLGDGYVINIAPVDGIPASFTSAKSVF
SSKALVKMQLLKDVVGNDTYRINNKYDETYPPLPVEEIIKRSEFVIGQEVAYNLLVNNCE HFVTLLRYGEGVSEQANRAISTVEFVTAAVGVFSFLGLFPKGQRAKYY |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Gamma type-C retroviral envelope protein family, HERV class-I H env subfamily
|
|||||
| Subcellular location |
Virion; Cell membrane
|
|||||
| Function |
Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution. This endogenous envelope protein has lost its original fusogenic properties but has immunosuppressive properties in vivo.; SU mediates receptor recognition.; TM anchors the envelope heterodimer to the viral membrane through one transmembrane domain. The other hydrophobic domain, called fusion peptide, mediates fusion of the viral membrane with the target cell membrane.
|
|||||
| Uniprot ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C185(0.80) | LDD1492 | [1] | |
Competitor(s) Related to This Target

