Details of the Target
General Information of Target
| Target ID | LDTP12206 | |||||
|---|---|---|---|---|---|---|
| Target Name | Aryl hydrocarbon receptor nuclear translocator 2 (ARNT2) | |||||
| Gene Name | ARNT2 | |||||
| Gene ID | 9915 | |||||
| Synonyms |
BHLHE1; KIAA0307; Aryl hydrocarbon receptor nuclear translocator 2; ARNT protein 2; Class E basic helix-loop-helix protein 1; bHLHe1 |
|||||
| 3D Structure | ||||||
| Sequence |
MNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAF
YAVKVLQKKSILKKKEQSHIMAERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGE LFFHLQRERRFLEPRARFYAAEVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGL CKEGVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVS QMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHVFFSPINWDDL YHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPE DDDILDC |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Transcription factor that plays a role in the development of the hypothalamo-pituitary axis, postnatal brain growth, and visual and renal function. Specifically recognizes the xenobiotic response element (XRE).
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| A549 | SNV: p.G455V | . | |||
| AGS | SNV: p.Q463Ter | DBIA Probe Info | |||
| COLO792 | SNV: p.P465L | DBIA Probe Info | |||
| DU145 | SNV: p.D484H | . | |||
| EFO27 | SNV: p.G531R | . | |||
| HCT15 | SNV: p.R240K | DBIA Probe Info | |||
| HSC3 | SNV: p.R234W | . | |||
| HT115 | SNV: p.R159Ter | . | |||
| LNCaP clone FGC | SNV: p.S205L | . | |||
| MEWO | Substitution: p.P376F | . | |||
| NCIH2286 | SNV: p.V192L | . | |||
| P31FUJ | SNV: p.L211F | . | |||
| SUPT1 | SNV: p.T335I | . | |||
| TOV21G | SNV: p.P9T | DBIA Probe Info | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C310(2.20) | LDD3332 | [1] | |
|
IPM Probe Info |
![]() |
C230(3.92) | LDD1702 | [2] | |
Competitor(s) Related to This Target
References


