Details of the Target
General Information of Target
| Target ID | LDTP12193 | |||||
|---|---|---|---|---|---|---|
| Target Name | Transcription initiation factor TFIID subunit 9B (TAF9B) | |||||
| Gene Name | TAF9B | |||||
| Gene ID | 51616 | |||||
| Synonyms |
TAF9L; Transcription initiation factor TFIID subunit 9B; Neuronal cell death-related protein 7; DN-7; Transcription initiation factor TFIID subunit 9-like; Transcription-associated factor TAFII31L |
|||||
| 3D Structure | ||||||
| Sequence |
MVEDELALFDKSINEFWNKFKSTDTSCQMAGLRDTYKDSIKAFAEKLSVKLKEEERMVEM
FLEYQNQISRQNKLIQEKKDNLLKLIAEVKGKKQELEVLTANIQDLKEEYSRKKETISTA NKANAERLKRLQKSADLYKDRLGLEIRKIYGEKLQFIFTNIDPKNPESPFMFSLHLNEAR DYEVSDSAPHLEGLAEFQENVRKTNNFSAFLANVRKAFTATVYN |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
TAF9 family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Essential for cell viability. TAF9 and TAF9B are involved in transcriptional activation as well as repression of distinct but overlapping sets of genes. May have a role in gene regulation associated with apoptosis. TAFs are components of the transcription factor IID (TFIID) complex, the TBP-free TAFII complex (TFTC), the PCAF histone acetylase complex and the STAGA transcription coactivator-HAT complex. TFIID or TFTC are essential for the regulation of RNA polymerase II-mediated transcription.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
m-APA Probe Info |
![]() |
11.69 | LDD0403 | [1] | |
|
DBIA Probe Info |
![]() |
C121(4.57) | LDD3311 | [2] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0167 | [3] | |
|
TFBX Probe Info |
![]() |
N.A. | LDD0027 | [4] | |
|
IPM Probe Info |
![]() |
N.A. | LDD0005 | [5] | |
|
AOyne Probe Info |
![]() |
15.00 | LDD0443 | [6] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Dr1-associated corepressor (DRAP1) | NC2 alpha/DRAP1 family | Q14919 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L (TAF6L) | TAF6 family | Q9Y6J9 | |||
References






