Details of the Target
General Information of Target
| Target ID | LDTP12189 | |||||
|---|---|---|---|---|---|---|
| Target Name | Tensin-1 (TNS1) | |||||
| Gene Name | TNS1 | |||||
| Gene ID | 7145 | |||||
| Synonyms |
TNS; Tensin-1; EC 3.1.3.- |
|||||
| 3D Structure | ||||||
| Sequence |
MAALRDAEIQKDVQTYYGQVLKRSADLQTNGCVTTARPVPKHIREALQNVHEEVALRYYG
CGLVIPEHLENCWILDLGSGSGRDCYVLSQLVGEKGHVTGIDMTKGQVEVAEKYLDYHME KYGFQASNVTFIHGYIEKLGEAGIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGE LYFSDVYTSLELPEEIRTHKVLWGECLGGALYWKELAVLAQKIGFCPPRLVTANLITIQN KELERVIGDCRFVSATFRLFKHSKTGPTKRCQVIYNGGITGHEKELMFDANFTFKEGEIV EVDEETAAILKNSRFAQDFLIRPIGEKLPTSGGCSALELKDIITDPFKLAEESDSMKSRC VPDAAGGCCGTKKSC |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
PTEN phosphatase protein family
|
|||||
| Subcellular location |
Cell surface
|
|||||
| Function |
May act as a protein phosphatase and/or a lipid phosphatase (Probable). Involved in fibrillar adhesion formation. Essential for myofibroblast differentiation and myofibroblast-mediated extracellular matrix deposition. Enhances RHOA activation in the presence of DLC1. Plays a role in cell polarization and migration. May be involved in cartilage development and in linking signal transduction pathways to the cytoskeleton.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C302(3.50) | LDD3455 | [1] | |
|
IPM Probe Info |
 |
C926(0.00); C1420(0.00) | LDD0147 | [2] | |
|
TFBX Probe Info |
 |
N.A. | LDD0148 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0213 | Electrophilic fragment 2 | MDA-MB-231 | C1316(1.71); C801(1.06) | LDD1702 | [3] |
| LDCM0022 | KB02 | Hs 839.T | C1669(3.24); C302(1.20) | LDD2361 | [1] |
| LDCM0023 | KB03 | MDA-MB-231 | C801(1.72); C1316(1.14) | LDD1701 | [3] |
| LDCM0024 | KB05 | SW1783 | C302(3.50) | LDD3455 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Hepatocyte growth factor receptor (MET) | Tyr protein kinase family | P08581 | |||
| Mast/stem cell growth factor receptor Kit (KIT) | Tyr protein kinase family | P10721 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Androgen receptor (AR) | Nuclear hormone receptor family | P10275 | |||
References