Details of the Target
General Information of Target
Target ID | LDTP12126 | |||||
---|---|---|---|---|---|---|
Target Name | Histone deacetylase complex subunit SAP30L (SAP30L) | |||||
Gene Name | SAP30L | |||||
Gene ID | 79685 | |||||
Synonyms |
NS4ATP2; Histone deacetylase complex subunit SAP30L; HCV non-structural protein 4A-transactivated protein 2; Sin3 corepressor complex subunit SAP30L; Sin3-associated protein p30-like |
|||||
3D Structure | ||||||
Sequence |
MLSEGYLSGLEYWNDIHWSCASYNEQVAGEKEEETNSVATLSYSSVDETQVRSLYVSCKS
SGKFISSVHSRESQHSRSQRVTVLQTNPNPVFESPNLAAVEICRDASRETYLVPSSCKSI CKNYNDLQIAGGQVMAINSVTTDFPSESSFEYGPLLKSSEIPLPMEDSISTQPSDFPQKP IQRYSSYWRITSIKEKSSLQMQNPISNAVLNEYLEQKVVELYKQYIMDTVFHDSSPTQIL ASELIMTSVDQISLQVSREKNLETSKARDIVFSRLLQLMSTEITEISTPSLHISQYSNVN P |
|||||
Target Bioclass |
Other
|
|||||
Family |
SAP30 family
|
|||||
Subcellular location |
Nucleus, nucleolus
|
|||||
Function |
[Isoform 1]: Functions as a transcription repressor, probably via its interaction with histone deacetylase complexes. Involved in the functional recruitment of the class 1 Sin3-histone deacetylase complex (HDAC) to the nucleolus. Binds DNA, apparently without sequence-specificity, and bends bound double-stranded DNA. Binds phosphoinositol phosphates (phosphoinositol 3-phosphate, phosphoinositol 4-phosphate and phosphoinositol 5-phosphate) via the same basic sequence motif that mediates DNA binding and nuclear import.; [Isoform 2]: Functions as a transcription repressor; isoform 2 has lower transcription repressor activity than isoform 1 and isoform 3.; [Isoform 3]: Functions as a transcription repressor; its activity is marginally lower than that of isoform 1.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C38(1.19) | LDD3383 | [1] | |
IA-alkyne Probe Info |
![]() |
C74(0.00); C38(0.00) | LDD0165 | [2] | |
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [3] | |
NAIA_5 Probe Info |
![]() |
C38(0.00); C74(0.00) | LDD2223 | [4] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References