Details of the Target
General Information of Target
| Target ID | LDTP12103 | |||||
|---|---|---|---|---|---|---|
| Target Name | Chondrolectin (CHODL) | |||||
| Gene Name | CHODL | |||||
| Gene ID | 140578 | |||||
| Synonyms |
C21orf68; Chondrolectin; Transmembrane protein MT75 |
|||||
| 3D Structure | ||||||
| Sequence |
MACGATLKRPMEFEAALLSPGSPKRRRCAPLPGPTPGLRPPDAEPPPPFQTQTPPQSLQQ
PAPPGSERRLPTPEQIFQNIKQEYSRYQRWRHLEVVLNQSEACASESQPHSSALTAPSSP GSSWMKKDQPTFTLRQVGIICERLLKDYEDKIREEYEQILNTKLAEQYESFVKFTHDQIM RRYGTRPTSYVS |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasm; Endoplasmic reticulum
|
|||||
| Function | May play a role in the development of the nervous system such as in neurite outgrowth and elongation. May be involved in motor axon growth and guidance. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C31(1.03) | LDD2263 | [1] | |
Competitor(s) Related to This Target

