Details of the Target
General Information of Target
| Target ID | LDTP12041 | |||||
|---|---|---|---|---|---|---|
| Target Name | Transducin-like enhancer protein 6 (TLE6) | |||||
| Gene Name | TLE6 | |||||
| Gene ID | 79816 | |||||
| Synonyms |
Transducin-like enhancer protein 6 |
|||||
| 3D Structure | ||||||
| Sequence |
MDPAARVVRALWPGGCALAWRLGGRPQPLLPTQSRAGFAGAAGGPSPVAAARKGSPRLLG
AAALALGGALGLYHTARWHLRAQDLHAERSAAQLSLSSRLQLTLYQYKTCPFCSKVRAFL DFHALPYQVVEVNPVRRAEIKFSSYRKVPILVAQEGESSQQLNDSSVIISALKTYLVSGQ PLEEIITYYPAMKAVNEQGKEVTEFGNKYWLMLNEKEAQQVYGGKEARTEEMKWRQWADD WLVHLISPNVYRTPTEALASFDYIVREGKFGAVEGAVAKYMGAAAMYLISKRLKSRHRLQ DNVREDLYEAADKWVAAVGKDRPFMGGQKPNLADLAVYGVLRVMEGLDAFDDLMQHTHIQ PWYLRVERAITEASPAH |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
WD repeat Groucho/TLE family
|
|||||
| Subcellular location |
Cytoplasm; Nucleus
|
|||||
| Function |
Regulates spermatogonia proliferation and cell cycle progression, potentially via regulation of cell cycle regulatory genes such as; CEBPB, CEBPA, CSF3, PCNA, and CDK4. Suppresses FOXG1/BF-1-mediated transcriptional repression by inhibiting interaction of the transcriptional corepressor TLE1 with FOXG1 which promotes cortical neuron differentiation. Acts as a transcriptional corepressor of NFATC1-mediated gene expression by contributing to PAX6-mediated repression.; [Isoform 1]: As a member of the subcortical maternal complex (SCMC), plays an essential role for zygotes to progress beyond the first embryonic cell divisions via regulation of actin dynamics. Required for the formation of F-actin cytoplasmic lattices in oocytes which in turn are responsible for symmetric division of zygotes via the regulation of mitotic spindle formation and positioning.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
TFBX Probe Info |
![]() |
N.A. | LDD0148 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Kallikrein-6 (KLK6) | Peptidase S1 family | Q92876 | |||
Other

