Details of the Target
General Information of Target
| Target ID | LDTP11985 | |||||
|---|---|---|---|---|---|---|
| Target Name | Transmembrane protein 231 (TMEM231) | |||||
| Gene Name | TMEM231 | |||||
| Gene ID | 79583 | |||||
| Synonyms |
Transmembrane protein 231 |
|||||
| 3D Structure | ||||||
| Sequence |
MEGMDVDLDPELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIG
AYYDFESPNISVPSMSFVEDVTIGEGESIPPDTQFVKTWRIQNSGAEAWPPGVCLKYVGG DQFGHVNMVMVRSLEPQEIADVSVQMCSPSRAGMYQGQWRMCTATGLYYGDVIWVILSVE VGGLLGVTQQLSSFETEFNTQPHRKVEGNFNPFASPQKNRQSDENNLKDPGGSEFDSISK NTWAPAPDTWAPAPDQTEQDQNRLSQNSVNLSPSSHANNLSVVTYSKGLHGPYPFGQS |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
TMEM231 family
|
|||||
| Subcellular location |
Cell projection, cilium membrane
|
|||||
| Function |
Transmembrane component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Required for ciliogenesis and sonic hedgehog/SHH signaling.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C70(1.48) | LDD3334 | [1] | |
Competitor(s) Related to This Target

