Details of the Target
General Information of Target
Target ID | LDTP11900 | |||||
---|---|---|---|---|---|---|
Target Name | Frizzled-8 (FZD8) | |||||
Gene Name | FZD8 | |||||
Gene ID | 8325 | |||||
Synonyms |
Frizzled-8; Fz-8; hFz8 |
|||||
3D Structure | ||||||
Sequence |
MSVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTK
NKRAALQALKRKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH DNMDIDKVDELMQDIADQQELAEEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNL LEISGPETVPLPNVPSIALPSKPAKKKEEEDDDMKELENWAGSM |
|||||
Target Bioclass |
GPCR
|
|||||
Family |
G-protein coupled receptor Fz/Smo family
|
|||||
Subcellular location |
Membrane
|
|||||
Function |
Receptor for Wnt proteins. Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalosomes. The beta-catenin canonical signaling pathway leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Coreceptor along with RYK of Wnt proteins, such as WNT1.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
IPM Probe Info |
![]() |
N.A. | LDD2156 | [1] |
The Interaction Atlas With This Target