Details of the Target
General Information of Target
| Target ID | LDTP11897 | |||||
|---|---|---|---|---|---|---|
| Target Name | Homeodomain-interacting protein kinase 3 (HIPK3) | |||||
| Gene Name | HIPK3 | |||||
| Gene ID | 10114 | |||||
| Synonyms |
DYRK6; FIST3; PKY; Homeodomain-interacting protein kinase 3; EC 2.7.11.1; Androgen receptor-interacting nuclear protein kinase; ANPK; Fas-interacting serine/threonine-protein kinase; FIST; Homolog of protein kinase YAK1
|
|||||
| 3D Structure | ||||||
| Sequence |
MTSVTRSEIIDEKGPVMSKTHDHQLESSLSPVEVFAKTSASLEMNQGVSEERIHLGSSPK
KGGNCDLSHQERLQSKSLHLSPQEQSASYQDRRQSWRRASMKETNRRKSLHPIHQGITEL SRSISVDLAESKRLGCLLLSSFQFSIQKLEPFLRDTKGFSLESFRAKASSLSEELKHFAD GLETDGTLQKCFEDSNGKASDFSLEASVAEMKEYITKFSLERQTWDQLLLHYQQEAKEIL SRGSTEAKITEVKVEPMTYLGSSQNEVLNTKPDYQKILQNQSKVFDCMELVMDELQGSVK QLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNPPAIHGSGSGSCQ |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, HIPK subfamily
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Serine/threonine-protein kinase involved in transcription regulation, apoptosis and steroidogenic gene expression. Phosphorylates JUN and RUNX2. Seems to negatively regulate apoptosis by promoting FADD phosphorylation. Enhances androgen receptor-mediated transcription. May act as a transcriptional corepressor for NK homeodomain transcription factors. The phosphorylation of NR5A1 activates SF1 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. In osteoblasts, supports transcription activation: phosphorylates RUNX2 that synergizes with SPEN/MINT to enhance FGFR2-mediated activation of the osteocalcin FGF-responsive element (OCFRE).
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
NAIA_5 Probe Info |
![]() |
C556(20.00) | LDD2227 | [1] | |
Competitor(s) Related to This Target

