Details of the Target

General Information of Target

Target ID	LDTP11840
Target Name	Zinc finger protein Eos (IKZF4)
Gene Name	IKZF4
Gene ID	64375
Synonyms	KIAA1782; ZNFN1A4; Zinc finger protein Eos; Ikaros family zinc finger protein 4
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MAKNPPENCEDCHILNAEAFKSKKICKSLKICGLVFGILALTLIVLFWGSKHFWPEVPKK AYDMEHTFYSNGEKKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKC FIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDN VTMYWINPTLISVSELQDFEEEGEDLHFPANEKKGIEQNEQWVVPQVKVEKTRHARQASE EELPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVIC RVIMPCNWWVARMLGRV
Target Bioclass	Transcription factor
Family	Ikaros C2H2-type zinc-finger protein family
Subcellular location	Nucleus
Function	DNA-binding protein that binds to the 5'GGGAATRCC-3' Ikaros-binding sequence. Transcriptional repressor. Interacts with SPI1 and MITF to repress transcription of the CTSK and ACP5 promoters via recruitment of corepressors SIN3A and CTBP2. May be involved in the development of central and peripheral nervous systems. Essential for the inhibitory function of regulatory T-cells (Treg). Mediates FOXP3-mediated gene silencing in regulatory T-cells (Treg) via recruitment of corepressor CTBP1.
Uniprot ID	Q9H2S9
Ensemble ID	ENST00000262032.9
HGNC ID	HGNC:13179

Target Site Mutations in Different Cell Lines

Cell line	Mutation details	Probe for labeling this protein in this cell
HCT15	SNV: p.S180N	.
HEC1	SNV: p.R323H	.
HEC1B	SNV: p.R323H	.
HT115	SNV: p.E572K	.
IM95	SNV: p.L442M	.
KPL1	SNV: p.T19N	.
LNCaP clone FGC	SNV: p.M1?	.
LOXIMVI	SNV: p.P83S	.
MCF7	SNV: p.T19N	.
MOLT4	SNV: p.M302V	.
SBC5	SNV: p.G469E	.
SHP77	SNV: p.T396R	.

Probe(s) Labeling This Target

ABPP Probe

Click To Hide/Show 1 Probe Related to This Target

Probe name		Structure	Binding Site(Ratio)	Interaction ID	Ref
Acrolein Probe Info			N.A.	LDD0225	[1]

Competitor(s) Related to This Target

Competitor ID	Name	Cell line	Binding Site(Ratio)	Interaction ID	Ref
LDCM0109	NEM	HeLa	N.A.	LDD0225	[1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme

Click To Hide/Show 3 Protein(s) Interacting with This Target

Protein name	Family	Uniprot ID
Casein kinase I isoform delta (CSNK1D)	CK1 Ser/Thr protein kinase family	P48730
Cell division cycle 7-related protein kinase (CDC7)	Ser/Thr protein kinase family	O00311
Tyrosine-protein kinase TXK (TXK)	Tyr protein kinase family	P42681

Other

Click To Hide/Show 4 Protein(s) Interacting with This Target

Protein name	Family	Uniprot ID
MOB kinase activator 1A (MOB1A)	MOB1/phocein family	Q9H8S9
MOB kinase activator 3C (MOB3C)	MOB1/phocein family	Q70IA8
Transcription elongation factor A protein 2 (TCEA2)	TFS-II family	Q15560
Microspherule protein 1 (MCRS1)	.	Q96EZ8

References

1	ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.